SecReT4
Protein ID: 116006881
T4SS name [ID]Tra_F [100]
Gene symboltraE
Locus tagpO86A1_p098
StrainEscherichia coli plasmid pO86A1 (NC_008460)
Repliconplasmid pO86A1 [GenBank: NC_008460] [Browse all T4SS(s) in this replicon]
Location [Strand]67620..68186 [+]
Productconjugal transfer pilus assembly protein TraE
Component typeTraE_F
UniProt IDQ08JH0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 1.7e-72, Aligned region: 1..187
Protein Sequence: 188 a.a.     [Download]
>gi|116006881|ref|YP_788064.1| conjugal transfer pilus assembly protein TraE [Escherichia coli]
MEHGARLSTSRVMAIAFIFMSVLIVLSLSVNVIQGVNNYRLQNEQRTAVTPMGFNVPFAVSQNSADASYL
QQMALSFIALRLNVSSETVDASHQALLQYIRPGAQNQMKVILAEEAKRIKNDNVNSAFFQTSVRVWPQYG
RVEIRGVLKTWIGDSKPFTDIKHYILILKRENGVTWLDNFGETDDEKK
 
Nucleotide Sequence: 567 bp     [Download]
>gi|116006783|ref|NC_008460.1|:67620-68186 Escherichia coli plasmid pO86A1, complete sequence
ATGGAACACGGTGCCCGTTTAAGTACCAGTCGTGTAATGGCCATCGCCTTTATATTTATGTCAGTGCTTA
TTGTTCTCAGCCTCTCTGTTAACGTCATTCAGGGGGTGAATAACTACCGTCTTCAGAATGAGCAACGCAC
TGCCGTGACCCCAATGGGATTTAATGTGCCCTTTGCCGTGTCACAGAACAGTGCCGACGCCTCTTATTTA
CAGCAGATGGCGCTGTCATTTATTGCCCTCCGTCTGAATGTTTCATCAGAAACCGTCGATGCCTCACATC
AGGCGCTTCTGCAATATATCCGCCCGGGCGCACAGAACCAGATGAAAGTTATTCTGGCTGAAGAAGCGAA
GCGTATTAAAAACGATAACGTGAACTCAGCCTTTTTCCAGACCAGTGTTCGTGTCTGGCCTCAGTATGGC
CGTGTGGAAATTCGTGGTGTGCTTAAAACCTGGATTGGTGATTCAAAACCTTTCACTGATATCAAACATT
ACATCCTTATTCTGAAGCGGGAAAACGGGGTGACCTGGCTGGATAATTTCGGGGAAACAGACGATGAGAA
AAAATAA