SecReT4
Protein ID: 116006893
T4SS name [ID]Tra_F [100]
Gene symboltrbC
Locus tagpO86A1_p110
StrainEscherichia coli plasmid pO86A1 (NC_008460)
Repliconplasmid pO86A1 [GenBank: NC_008460] [Browse all T4SS(s) in this replicon]
Location [Strand]77215..77853 [+]
Productconjugal transfer pilus assembly protein TrbC
Component typeTrbC_F
UniProt IDQ08JF8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 7.7e-28, Aligned region: 94..191
Protein Sequence: 212 a.a.     [Download]
>gi|116006893|ref|YP_788076.1| conjugal transfer pilus assembly protein TrbC [Escherichia coli]
MNRKIFALFALTAGMHLAVHASENVNTTENRQFLKQQETLSQQLREKPDTQLQAWAEQQVRANPLQHSDN
QFLDELVRKQQAAQKDKPQQGAVYFVSFSIPEEGLKRMLSETRHYGIPATLRGMVNNDLKTTAEAVLSLV
KDGATDGVQIDPTLFSQYGIRSVPALVVFCSQGYDIIWGNLRVGQALEKVAATGDCRQVAHDLLAGKGDS
GK
 
Nucleotide Sequence: 639 bp     [Download]
>gi|116006783|ref|NC_008460.1|:77215-77853 Escherichia coli plasmid pO86A1, complete sequence
ATGAACCGGAAAATATTTGCACTTTTTGCTCTGACAGCAGGGATGCATCTTGCTGTTCATGCTTCAGAAA
ATGTGAACACAACTGAAAACCGCCAGTTCCTGAAGCAGCAGGAAACACTGAGTCAGCAGTTACGTGAAAA
GCCGGACACACAGTTGCAGGCATGGGCAGAGCAGCAGGTCAGGGCGAATCCCCTTCAGCATTCCGATAAC
CAGTTTCTCGATGAACTGGTCCGTAAACAGCAGGCTGCTCAGAAGGATAAACCACAGCAGGGCGCCGTGT
ACTTTGTGTCCTTCTCCATTCCCGAAGAGGGGCTGAAACGGATGCTGAGCGAAACCCGGCACTACGGTAT
TCCGGCCACACTGCGGGGCATGGTGAACAATGACCTGAAGACCACCGCTGAAGCCGTGCTGTCCCTGGTG
AAAGACGGCGCAACTGATGGTGTTCAGATCGACCCGACGCTGTTTTCACAGTACGGCATTCGCAGCGTAC
CGGCATTGGTGGTGTTCTGCAGTCAGGGATACGACATCATCTGGGGAAACCTGCGGGTCGGCCAGGCGCT
GGAGAAAGTGGCCGCCACGGGTGACTGCCGGCAGGTGGCTCATGATTTACTGGCAGGGAAAGGAGATTCC
GGGAAATGA