SecReT4
Protein ID: 116006894
T4SS name [ID]Tra_F [100]
Gene symboltraN
Locus tagpO86A1_p111
StrainEscherichia coli plasmid pO86A1 (NC_008460)
Repliconplasmid pO86A1 [GenBank: NC_008460] [Browse all T4SS(s) in this replicon]
Location [Strand]77850..79700 [+]
Productconjugal transfer mating pair stabilization protein TraN
Component typeTraN_F
UniProt IDQ08JF7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 2.2e-77, Aligned region: 321..566
Protein Sequence: 616 a.a.     [Download]
>gi|116006894|ref|YP_788077.1| conjugal transfer mating pair stabilization protein TraN [Escherichia coli]
MKRILPLILALVAGMAQADSNSDYRAGSDFAHQIKGQGSSSIQGFKPQESIPDYNANPDETKYYGGVTAG
GDGGLKNDGTTEWATGETGKTITESFMNKPKDILSPDAPFIQTGRDVVNRADSIVGNTGQQCSAQEINRS
EFTNYTCERDTMVEEYCTRTASITGDWKYTDEYREVTIPHSQFRFSMNGLKLVFSVTVPVAGTVESASLS
VHAGLYFLNSRYDFMNTAFNVQLVTGQSGTFTIPVPSGFSVTQGQVLTGSGCTANGNCLPHGNGDRKVYE
SLVSGASTFTLKLRMKVRDKEWVPRVEWVESCPFNKADGVLTGTECSEPGGTKTGVMEGKPWNITQACWA
YRDKYVTQSADNGTCQKYVDNPACTLASRQCAFYSDEGTCLHEYATYSCESKTSGKVMVCGGDVFCLDGE
CDKAQSGKSSDFGEAVSQLAALAAAGKDVAALNGVDVRAFTGEAKFCRKAAAGFSNCCKDGGWGQDVGLA
KCNSEEKALGKAKDNKLTVSVGEFCSKKVLGVCLQKKRSYCQFDSKLAQIVQQQGRNGQLRIGFGSAKHP
DCRGITVDELQKIQFDRLDFTNFYEDLMNNQKIPDSGVLTQKVKEQIADQLKQAGQ
 
Nucleotide Sequence: 1851 bp     [Download]
>gi|116006783|ref|NC_008460.1|:77850-79700 Escherichia coli plasmid pO86A1, complete sequence
ATGAAACGTATTTTACCTCTGATACTGGCTCTGGTTGCCGGCATGGCACAGGCTGACAGCAACAGTGATT
ACCGGGCCGGTTCTGATTTTGCTCACCAGATCAAAGGGCAGGGAAGCAGCAGTATTCAGGGCTTTAAGCC
ACAGGAGAGTATCCCCGACTATAACGCGAATCCGGACGAGACAAAATATTACGGTGGCGTGACTGCCGGC
GGGGATGGCGGCCTGAAAAATGACGGCACCACGGAATGGGCGACCGGTGAAACCGGAAAAACTATCACAG
AGTCATTCATGAACAAGCCGAAAGACATTCTTTCACCGGATGCGCCGTTTATCCAGACTGGCAGGGATGT
GGTGAACCGGGCTGACAGCATTGTGGGAAATACCGGACAGCAGTGCAGTGCGCAGGAGATAAACCGCAGT
GAATTCACAAACTATACCTGTGAGCGGGACACGATGGTGGAGGAGTACTGCACACGGACTGCCAGTATCA
CCGGGGACTGGAAATACACGGATGAATATCGTGAGGTGACGATACCTCACTCACAGTTCCGGTTCAGTAT
GAACGGTCTGAAACTGGTGTTCAGCGTTACCGTACCTGTTGCCGGGACAGTGGAAAGTGCCTCGCTATCG
GTTCATGCAGGGCTATATTTCCTTAACTCCCGTTACGACTTTATGAACACAGCCTTTAATGTGCAACTGG
TTACAGGACAGAGCGGGACTTTCACCATACCTGTGCCCTCCGGGTTTTCTGTCACACAGGGGCAGGTTCT
GACCGGTAGTGGCTGTACTGCAAACGGTAATTGCCTCCCGCACGGGAATGGTGACAGGAAAGTCTATGAA
TCGCTTGTCAGTGGTGCTTCCACCTTTACGCTGAAACTCAGGATGAAGGTCCGTGATAAAGAATGGGTTC
CCCGGGTGGAGTGGGTGGAGAGTTGTCCGTTTAATAAAGCGGATGGCGTGCTGACAGGCACTGAGTGTTC
AGAGCCGGGTGGTACGAAAACCGGAGTGATGGAAGGTAAACCCTGGAACATCACACAGGCATGCTGGGCA
TACCGGGATAAATATGTCACTCAGTCCGCAGATAACGGCACCTGTCAGAAATATGTCGATAATCCGGCCT
GTACGCTGGCCTCACGTCAGTGCGCGTTTTATTCCGATGAGGGAACCTGTCTGCATGAGTACGCCACGTA
CTCCTGCGAGTCAAAAACATCAGGAAAAGTGATGGTCTGTGGTGGTGATGTCTTCTGCCTTGACGGTGAA
TGCGATAAGGCACAGAGCGGAAAAAGCAGTGATTTTGGTGAAGCAGTATCACAGCTGGCTGCGCTTGCCG
CCGCAGGTAAGGATGTTGCCGCCCTGAATGGTGTGGATGTCAGGGCTTTCACGGGTGAGGCGAAATTCTG
CCGTAAGGCCGCAGCCGGCTTCAGTAACTGCTGTAAGGATGGCGGCTGGGGTCAGGATGTGGGGCTGGCG
AAGTGTAACAGTGAAGAAAAGGCGCTGGGAAAGGCAAAGGACAATAAACTGACGGTGAGTGTGGGTGAGT
TCTGTTCGAAAAAGGTGCTGGGGGTCTGCCTGCAGAAAAAGCGCAGCTACTGCCAGTTTGATTCGAAGCT
GGCGCAGATAGTCCAGCAGCAGGGGCGTAACGGGCAGTTGCGTATCGGGTTTGGCAGTGCGAAGCATCCT
GACTGTCGGGGGATTACGGTTGATGAGCTGCAGAAAATTCAGTTCGACAGACTGGATTTCACTAACTTCT
ACGAAGACCTGATGAATAACCAGAAAATCCCGGACAGTGGCGTTCTGACGCAGAAAGTGAAAGAGCAGAT
TGCTGACCAGCTGAAACAGGCAGGACAGTAA