SecReT4
Protein ID: 116006903
T4SS name [ID]Tra_F [100]
Gene symboltraG
Locus tagpO86A1_p120
StrainEscherichia coli plasmid pO86A1 (NC_008460)
Repliconplasmid pO86A1 [GenBank: NC_008460] [Browse all T4SS(s) in this replicon]
Location [Strand]84025..86847 [+]
Productconjugal transfer mating pair stabilization protein TraG
Component typeTraG_F
UniProt IDQ08JE8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 2.2e-124, Aligned region: 3..450
Protein Sequence: 940 a.a.     [Download]
>gi|116006903|ref|YP_788086.1| conjugal transfer mating pair stabilization protein TraG [Escherichia coli]
MNEVYVIAGGEWLRNNLNAIAAFMSTRTWDSIEKIALTLSVVAVAFMWVQRHNVMDLLGWVAVFVLISLL
VNVRTSVQIIDNSDLVQVHRVDNVPVGLAMPLSLTTRIGHAMVVSYEMIFTQPDSVTYSKTGMLFGANLI
VKSTDFLSRNPEIINLFQDYVQNCVLGDIYLNHKYTLEDLMASADSYTLIFSRPSPLRGVYDNNNNFITC
KDASVTLKDRLNLDTKTGGKTWHYYVQQIFGGRPDPDLLFRQLVSDSYSYFYGSSQSASQIMRQNVTMNA
LKEGITSNAARNGDTASLVNLATTSSMEKQRLAHVSIGHVTMRNLPMVQTILTGIAIGIFPLLVLAAVFN
KLTLSVLKGYVFALMWLQTWPLLYAILNSAMTFYAKMNGAPVVLSELSQIQLKYSDLASTAGYLSAMIPP
LSWMMVKGLGAGFSSVYSHFASSSISPTASAAGSVVDGNYSYGNMQTENVNGFSWSTNSTTSFGQMMYQT
GSGATATQTRDGNMVMDASGAMSRLPVGIKATRQIAAAQQEMAREASNRAESALHGFSSSIASAWNSLSQ
FGSNRGSSDSVTGGADSTMSAQDSMMASRMRSAVESYAKAHNISNEQATQELASRSTRASAGMYGDAHAE
WGVKPKILGVGGGLGVKGGGRAGIDWEDNDAHTASSNTQSSHNARHDIDARATQDFKEASDYFTSRKVSE
SGSHTDNNADSRVDQLSAALNSAKQSYDQYTTNMTRSHEYAEMASRTESMSGQMSEDLSQQFAQYVMKHA
PQDAEAILTNTSSPEIAERRRAMAWSFVQEQVQPGVDNAWRESRGDIGKGMESVPSGGGSQDIIADHQGH
QAIIEQGTQDSNIRNDVKHQVDNMVTEYKGNIGDTQNSMRGEENIVRGQYSELQNHHKTEALSQNNKYNE
EKSAQERMPGADSPQELMKRAKEYQDKYKQ
 
Nucleotide Sequence: 2823 bp     [Download]
>gi|116006783|ref|NC_008460.1|:84025-86847 Escherichia coli plasmid pO86A1, complete sequence
GTGAATGAAGTTTATGTGATTGCCGGTGGTGAGTGGTTGCGGAATAACCTGAACGCCATTGCGGCATTTA
TGAGTACGCGGACCTGGGATTCCATTGAAAAAATTGCGCTCACCCTGTCTGTTGTTGCTGTGGCTTTTAT
GTGGGTACAGCGGCACAACGTGATGGATTTACTGGGCTGGGTGGCGGTGTTTGTGCTTATCAGCCTGCTG
GTTAATGTCCGCACATCGGTGCAAATTATTGATAACAGTGACCTGGTCCAGGTTCACCGGGTGGATAATG
TTCCGGTCGGTCTGGCGATGCCACTTTCTCTTACGACCCGTATCGGGCATGCGATGGTGGTCAGCTACGA
GATGATATTCACCCAACCGGACAGCGTCACCTACAGCAAGACAGGCATGCTGTTCGGGGCGAATCTGATT
GTGAAAAGCACCGATTTCCTGTCCCGGAATCCGGAAATCATCAATCTGTTCCAGGACTACGTCCAGAACT
GCGTGCTGGGTGATATTTACCTGAATCATAAATACACGCTGGAAGATCTGATGGCCTCCGCTGACTCCTA
CACGCTGATTTTTTCCCGACCCAGCCCGCTACGGGGCGTTTATGACAACAATAATAATTTCATAACCTGT
AAGGATGCGTCGGTCACGCTGAAAGACAGGCTGAATCTCGATACAAAGACGGGAGGCAAGACCTGGCATT
ATTATGTGCAGCAGATATTTGGCGGCAGACCGGACCCGGACCTGTTATTCAGACAACTGGTCAGTGACAG
TTACAGTTATTTCTACGGCTCCAGTCAGTCTGCCAGCCAGATTATGCGCCAGAACGTCACCATGAATGCC
CTGAAAGAGGGTATCACCAGTAATGCCGCCCGTAATGGTGACACCGCCAGCTTGGTGAATCTGGCCACCA
CGTCATCGATGGAGAAGCAACGTCTGGCGCATGTCTCTATCGGTCATGTGACAATGCGAAACCTGCCAAT
GGTACAGACTATCCTGACGGGAATTGCCATTGGTATTTTCCCGCTTCTGGTACTGGCAGCTGTCTTCAAC
AAACTGACACTGTCCGTCCTGAAAGGCTATGTGTTTGCCCTGATGTGGCTGCAGACCTGGCCGTTGTTGT
ATGCCATTCTGAACAGTGCCATGACATTCTATGCGAAGATGAATGGTGCGCCGGTCGTGCTGTCTGAACT
CTCTCAGATACAGCTGAAATACTCTGACCTGGCCTCTACTGCCGGGTATCTTTCAGCCATGATCCCCCCG
TTGTCATGGATGATGGTAAAAGGCCTTGGCGCAGGTTTTTCCAGCGTGTACAGCCACTTCGCCTCTTCCT
CTATCAGTCCGACGGCCAGTGCAGCAGGCAGTGTGGTTGACGGTAATTACTCCTACGGCAACATGCAGAC
GGAAAACGTGAACGGCTTCAGCTGGAGCACCAACAGCACCACGTCGTTTGGTCAGATGATGTACCAGACC
GGCAGTGGCGCAACTGCCACACAGACCCGTGACGGTAATATGGTGATGGATGCAAGCGGAGCGATGTCCC
GTTTACCGGTCGGTATCAAAGCAACGCGTCAGATTGCAGCGGCGCAACAGGAAATGGCCCGGGAGGCGTC
GAACAGAGCAGAAAGTGCCCTGCATGGTTTCAGCAGCAGTATTGCCAGTGCCTGGAACTCGCTCAGTCAG
TTTGGTTCTAACCGGGGGAGCAGTGATTCTGTCACCGGTGGTGCTGACAGTACGATGAGCGCACAGGACT
CCATGATGGCCAGCCGTATGCGCAGTGCAGTGGAAAGCTATGCGAAGGCGCATAATATCAGTAATGAGCA
GGCGACTCAGGAACTGGCATCCAGAAGTACGAGAGCTTCTGCCGGGATGTATGGAGATGCTCATGCTGAA
TGGGGGGTTAAACCTAAAATTCTTGGTGTTGGTGGCGGCTTAGGTGTTAAAGGTGGTGGTCGCGCTGGTA
TTGATTGGGAAGATAATGATGCGCATACGGCAAGTAGTAATACTCAGTCGAGCCATAATGCTCGTCATGA
TATCGATGCCAGAGCTACACAAGACTTTAAAGAGGCCAGCGATTACTTTACCAGTCGCAAGGTCAGTGAG
TCCGGCAGCCATACTGATAATAATGCTGATTCCCGTGTGGATCAGTTGTCTGCAGCCCTGAATTCAGCGA
AGCAGAGTTACGACCAGTACACGACGAATATGACCCGCAGCCATGAATATGCTGAAATGGCATCCCGTAC
TGAAAGCATGAGTGGGCAGATGAGTGAAGACTTGTCGCAACAGTTTGCACAGTATGTAATGAAACACGCG
CCACAGGATGCAGAAGCTATTCTGACAAACACCAGTTCACCGGAGATTGCAGAACGTCGTCGGGCGATGG
CCTGGTCTTTTGTGCAGGAACAGGTACAGCCTGGTGTTGATAATGCCTGGCGGGAATCCCGTGGCGATAT
TGGTAAAGGAATGGAGAGCGTACCTTCGGGTGGTGGCAGTCAGGATATTATTGCTGACCATCAGGGACAT
CAGGCCATTATTGAGCAAGGAACGCAGGACAGTAATATCCGTAATGATGTAAAACATCAGGTTGATAATA
TGGTCACAGAATATAAAGGGAATATAGGTGATACTCAGAACAGCATGCGTGGTGAGGAAAATATTGTAAG
AGGACAGTATTCTGAACTGCAGAATCACCATAAAACAGAGGCATTATCTCAGAATAATAAATATAATGAA
GAAAAGTCGGCTCAGGAAAGAATGCCCGGGGCTGACAGTCCACAGGAACTTATGAAAAGGGCAAAGGAAT
ATCAGGATAAGTATAAGCAATAA