SecReT4
Protein ID: 116006908
T4SS name [ID]Tra_F [100]
Gene symboltraI
Locus tagpO86A1_p125
StrainEscherichia coli plasmid pO86A1 (NC_008460)
Repliconplasmid pO86A1 [GenBank: NC_008460] [Browse all T4SS(s) in this replicon]
Location [Strand]91291..96561 [+]
Productconjugal transfer nickase/helicase TraI
Component typeTraI_F
UniProt IDQ08JE3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 2e-88, Aligned region: 7..287
TraI [PF07057], Evalue: 6.6e-58, Aligned region: 1434..1560
AAA_30 [PF13604], Evalue: 2e-42, Aligned region: 968..1156
UvrD_C_2 [PF13538], Evalue: 1.9e-05, Aligned region: 1341..1444
AAA_19 [PF13245], Evalue: 2.4e-05, Aligned region: 982..1047
Protein Sequence: 1756 a.a.     [Download]
>gi|116006908|ref|YP_788091.1| conjugal transfer nickase/helicase TraI [Escherichia coli]
MLSFSVVKSAGSAGNYYTDKDNYYVLGSMGERWAGQGAEQLGLQGSVDKDVFTRLLEGRLPDGADLSRMQ
DGSNKHRPGYDLTFSAPKSVSMMAMLGGDKRLIDAHNQAVDFAVRQVEALASTRVMTDGQSETVLTGNLV
MALFNHDTSRDQDPQLHTHVVVANVTQHNGEWKTLSSDKVGKTGFSENVLANRIAFGKIYQSELRQRVEA
LGYETEVVGKHGMWEMPGVPVEAFSSRSQAIREAVGEGASLKSRDVAALDTRKSKQHVDPEIRMAEWMQT
LKETGFDIRAYRDAADQRAEIRTQAPGPASQDGPDVQQAVTQAIAGLSERKVQFTYTDVLARTVGILPPE
NGVIERARVGIDEAISREQLIPLDREKGLFTSGIHVLDELSVRALSRDIMKQNRVTVHPEKSVPRTAGYS
DAVSVLAQDRPSLAIVSGQGGAAGQRERVAELVMMAREQGREVQIIAADRRSQMNLKQDERLSGELITGR
RQLQDGMTFTPGSTVIVDQGEKLSLKETLTLLDGAARHNVQILITDSGQRTGTGSALMSMKEAGVNTYRW
QGGEQRPATIISEPDRNVRYARLAGDFAASVKAGEESVAQVSGVREQAILTQSIRSELKTQGVLGHPEVT
MTALSPVWLDSRSRYLRDMYRPGMVMEQWNPETRSHDRYVIDRVTAQSHSLTLRNAQGETQVVRISSLDS
SWSLFRPEKMPVADGERLRVTGKIPGLRVSGGDRLQVASVSEDAMTVVVPGRAEPATLPVADSPFTALKL
ENGWVETPGHSVSDSATVFASVTQMAMDNATLNGLARSGRDVRLYSSLDETRTAEKLARHPSFTVVSEQI
KARAGETSLETAISLQKAGLHTPAQQAIHLALPVLESKNLAFNMVDLLTEAKSFAAEGTGCTELGGEINA
QIKRGDLLYVDVAKGYGTGLLVSRASYEAEKSILRHILEGKEAVTPLMERVPGELMETLTSGQRAATRMI
LETSDRFTVVQGYAGVGKTTQFRAVMSAVNMLPASERPRVVGLGPTHRAVGEMRSAGVDAQTLASFLHDT
QLQQRSGETPDFSNTLFLLDESSMVGNTDMARAYALIAAGGGRAVASGDTDQLQAIAPGQPFRLQQTRSA
ADVVIMKEIVRQTPELREAVYSLINRDVERALSGLESVKPSQVPRQEGAWAPEHSVTEFSHSQEAKLAEA
QQKAMLKGETFPDVPMTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIHDAREKAGELGKEQVM
VPVLNTANIRDGELRRLSTWENNPDALALVDNVYHRIAGISKDDGLITLEDAEGNTRLISPREAVAEGVT
LYTPDKIRVGTGDRMRFTKSDRERGYVANSVWTVTAVSGDSVTLSDGQQTRVIRPGQERAEQHIDLAYAI
TAHGAQGASETFAIALEGTEGNRKLMAGFESAYVALSRMKQHVQVYTDNRQGWTDAINNAVQKGTAHDVF
EPKPDREVMNAERLFSTARELRDVAAGRAVLRQAGLAGGDSPARFIAPGRKYPQPYVALPAFDCNGRSAG
IWLNPLTTDDGNGLRGFSGEGRVKGSGDAQFVALQGSRNGESLLADNMQDGVRIARDNPDSGVVVRIAGE
GRPWNPGAITGGRVWGDIPDSSVQPGAGNGEPVTAEVLAQRQAEEAIRRETERRADEIVRKMAENKPDLP
DGKTEQAVREIAGQERDRADITEREAALPESVLRESQREQEAVREVARENLLQERLQQMERDMVHDLQKE
KTLGGD
 
Nucleotide Sequence: 5271 bp     [Download]
>gi|116006783|ref|NC_008460.1|:91291-96561 Escherichia coli plasmid pO86A1, complete sequence
ATGTTGAGTTTCAGCGTTGTTAAATCGGCAGGCAGTGCCGGAAACTATTACACCGACAAGGATAATTACT
ATGTGCTGGGCAGCATGGGAGAACGCTGGGCCGGTCAGGGGGCTGAACAGCTTGGGCTGCAGGGCAGCGT
CGATAAGGATGTTTTTACCCGTCTTCTGGAGGGCAGGCTGCCGGACGGGGCGGATTTAAGCCGCATGCAG
GATGGCAGTAATAAGCATCGTCCCGGCTACGACCTGACCTTCTCCGCCCCCAAAAGTGTCTCCATGATGG
CCATGCTCGGGGGGGATAAACGTCTTATTGATGCACATAACCAGGCCGTGGATTTTGCTGTCCGTCAGGT
GGAGGCGCTGGCTTCCACACGGGTGATGACGGACGGACAGTCAGAAACGGTGCTGACCGGTAATCTGGTG
ATGGCACTGTTTAACCATGACACCAGTCGCGATCAGGACCCACAGTTACACACGCATGTGGTGGTGGCTA
ATGTCACGCAGCATAACGGCGAGTGGAAGACACTGAGCAGTGACAAAGTGGGGAAAACCGGATTTTCCGA
GAACGTGCTCGCGAACCGGATTGCGTTCGGGAAAATATATCAGAGTGAGTTACGTCAGCGCGTTGAGGCG
CTGGGTTATGAAACCGAAGTGGTCGGTAAGCACGGTATGTGGGAGATGCCGGGCGTACCGGTGGAGGCCT
TTTCCAGTCGTTCACAGGCTATCAGGGAGGCCGTCGGGGAAGGGGCCTCACTGAAATCCCGGGATGTGGC
GGCACTGGATACGCGTAAATCCAAACAGCACGTCGATCCGGAAATCAGAATGGCTGAATGGATGCAGACG
CTGAAGGAAACCGGGTTCGACATCCGGGCATATCGTGACGCGGCGGATCAGCGTGCGGAGATCCGCACGC
AGGCGCCCGGGCCAGCTTCACAGGACGGGCCGGATGTGCAGCAGGCGGTGACACAGGCGATTGCCGGATT
AAGTGAACGAAAAGTGCAGTTCACGTATACGGACGTGCTGGCCAGGACGGTCGGCATACTGCCGCCGGAA
AATGGTGTGATTGAACGGGCACGCGTCGGTATCGATGAGGCCATCAGCCGTGAGCAGCTTATCCCCCTCG
ATCGTGAGAAGGGGCTGTTCACGTCCGGGATTCATGTGCTCGATGAGCTGTCAGTCCGGGCACTCAGTCG
TGACATCATGAAACAGAACCGGGTGACCGTACATCCGGAGAAAAGTGTCCCCCGGACGGCCGGTTACAGC
GATGCCGTCAGTGTTCTGGCACAGGATCGCCCGTCGCTGGCCATTGTGTCCGGGCAGGGCGGTGCAGCCG
GGCAGCGTGAGCGGGTGGCTGAACTGGTCATGATGGCCCGGGAGCAGGGGCGGGAGGTGCAGATTATCGC
TGCTGACCGTCGCTCGCAGATGAACCTGAAGCAGGATGAACGGCTGTCCGGTGAACTGATAACCGGACGT
CGTCAGCTGCAGGATGGCATGACCTTCACACCGGGCAGTACCGTTATCGTTGACCAGGGCGAAAAACTCT
CCCTGAAAGAGACGTTAACCCTGCTGGACGGTGCCGCACGTCATAACGTACAGATCCTGATAACCGACAG
CGGGCAGCGAACCGGTACAGGCAGTGCGCTGATGTCCATGAAGGAGGCCGGGGTGAACACATATCGCTGG
CAGGGCGGAGAACAGCGACCGGCCACCATCATCAGTGAACCGGACCGTAATGTCCGCTATGCCCGGCTGG
CCGGAGATTTTGCGGCCAGCGTGAAAGCCGGAGAAGAGAGCGTGGCACAGGTCAGCGGGGTACGGGAACA
GGCCATACTGACACAGTCCATTCGCAGTGAGCTGAAAACGCAGGGCGTGCTCGGACACCCTGAGGTGACC
ATGACTGCACTGTCACCGGTCTGGCTGGACAGCCGGAGCCGTTATCTGCGGGATATGTACCGTCCGGGGA
TGGTGATGGAGCAGTGGAACCCGGAGACACGCAGTCATGACCGCTATGTGATAGACCGGGTGACAGCGCA
GAGTCACAGCCTGACCCTGCGGAATGCGCAGGGCGAAACGCAGGTGGTGCGTATTTCCTCCCTGGACAGC
AGCTGGTCGCTGTTCCGGCCGGAAAAAATGCCGGTGGCAGACGGCGAGCGACTGAGGGTGACAGGGAAAA
TTCCCGGACTCCGCGTCTCCGGCGGTGACCGCCTGCAGGTGGCATCCGTCAGTGAAGATGCGATGACGGT
TGTTGTGCCGGGGCGGGCTGAACCGGCCACCCTGCCTGTGGCTGATTCACCGTTCACGGCACTGAAGCTG
GAGAACGGCTGGGTGGAAACGCCCGGGCATTCCGTCAGTGACAGTGCGACGGTGTTTGCCTCCGTCACAC
AGATGGCAATGGACAACGCCACCCTGAACGGTCTGGCCCGCAGCGGTCGTGATGTCCGGCTGTATTCCTC
ACTGGATGAAACCCGTACTGCGGAAAAACTTGCCCGCCATCCCTCCTTTACGGTGGTTTCTGAGCAGATA
AAGGCGCGGGCCGGTGAGACATCGCTGGAAACCGCTATCAGTCTGCAGAAAGCCGGGCTGCACACGCCGG
CACAGCAGGCCATTCATCTGGCCCTTCCTGTGCTGGAAAGTAAAAACCTGGCCTTCAACATGGTGGACCT
GCTGACAGAGGCGAAGTCGTTTGCTGCAGAAGGAACCGGTTGTACTGAACTGGGAGGGGAAATCAATGCG
CAGATAAAACGCGGTGACTTACTGTATGTGGATGTGGCAAAAGGCTATGGCACAGGCCTGCTGGTTTCCC
GTGCGTCGTATGAGGCAGAAAAAAGTATTCTTCGCCATATTCTCGAAGGTAAGGAGGCGGTCACGCCGCT
GATGGAGAGAGTACCCGGCGAACTCATGGAGACGTTAACGTCGGGACAGCGTGCCGCCACCCGTATGATA
CTGGAAACGTCCGACCGTTTCACGGTGGTACAGGGTTATGCCGGTGTGGGTAAGACCACACAGTTCCGGG
CGGTGATGTCAGCCGTGAACATGCTGCCGGCGAGTGAGCGTCCCCGAGTTGTGGGGCTGGGGCCCACGCA
CCGTGCGGTCGGTGAGATGCGCAGCGCCGGCGTGGATGCACAGACGCTGGCGTCCTTTCTGCATGACACG
CAGCTGCAGCAGCGCAGCGGAGAAACGCCGGATTTCAGCAACACGCTGTTCCTGCTCGATGAGAGCTCAA
TGGTGGGCAATACCGACATGGCACGGGCATACGCCCTGATTGCGGCCGGTGGCGGTCGTGCCGTGGCCAG
TGGTGACACGGACCAGCTGCAGGCCATCGCGCCCGGTCAGCCTTTCCGTCTCCAGCAGACGCGCAGTGCT
GCCGATGTGGTCATCATGAAGGAGATTGTGCGTCAGACGCCGGAACTGCGGGAGGCGGTATACAGCCTGA
TTAACCGGGATGTGGAAAGGGCACTGTCCGGGCTTGAGAGTGTGAAACCGTCTCAGGTTCCCCGTCAGGA
GGGCGCATGGGCACCGGAGCACTCCGTGACGGAGTTCAGTCACAGCCAGGAAGCGAAACTGGCAGAAGCG
CAGCAGAAGGCGATGCTGAAAGGTGAGACTTTTCCGGATGTCCCCATGACACTGTATGAAGCCATTGTCC
GCGACTATACCGGCAGGACACCGGAAGCACGGGAGCAGACGCTGATTGTCACGCACCTGAATGAGGACCG
GCGCGTACTGAACAGCATGATTCATGATGCACGGGAAAAGGCCGGTGAGCTGGGGAAAGAGCAGGTCATG
GTGCCTGTCCTGAACACAGCGAATATACGTGACGGGGAGCTGCGTCGTCTCTCCACCTGGGAGAATAACC
CGGATGCCCTTGCCCTGGTGGATAATGTGTATCACCGGATTGCCGGTATCAGCAAGGATGACGGGCTGAT
AACCCTGGAGGATGCGGAAGGTAACACGCGGCTGATTTCGCCCCGGGAGGCGGTGGCTGAAGGTGTCACA
CTGTACACCCCGGACAAAATCCGGGTGGGGACCGGCGACCGGATGCGCTTCACGAAGAGTGACCGGGAGC
GCGGTTATGTGGCCAACAGCGTCTGGACGGTGACAGCGGTTTCTGGTGACAGTGTCACGCTGTCGGACGG
CCAGCAGACCCGGGTGATTCGCCCCGGTCAGGAGCGGGCAGAGCAACATATTGACCTGGCCTATGCCATC
ACCGCCCACGGTGCGCAGGGGGCGAGTGAAACCTTTGCCATCGCGCTTGAAGGCACGGAAGGTAACCGGA
AACTGATGGCCGGCTTTGAGTCAGCCTACGTGGCCCTGTCGCGTATGAAGCAGCATGTGCAGGTGTACAC
CGATAACCGTCAGGGCTGGACGGATGCCATCAACAATGCCGTACAGAAAGGAACGGCCCACGATGTGTTT
GAACCGAAACCGGACCGGGAGGTCATGAATGCAGAGCGGCTGTTCAGTACGGCACGGGAACTGCGGGACG
TGGCGGCAGGCCGTGCCGTTCTCCGTCAGGCGGGGCTGGCCGGGGGAGACAGTCCTGCACGGTTTATTGC
TCCGGGACGTAAATATCCGCAGCCGTATGTGGCACTGCCGGCGTTTGACTGTAACGGCAGGTCCGCCGGT
ATCTGGCTGAACCCACTGACCACGGATGACGGAAACGGGCTGCGGGGATTCAGCGGTGAAGGACGGGTGA
AAGGCAGCGGGGATGCGCAGTTCGTGGCCCTGCAGGGCAGCCGTAACGGAGAGAGCCTGCTGGCTGATAA
TATGCAGGATGGTGTCCGGATTGCCCGTGATAATCCTGACAGCGGTGTGGTGGTAAGAATTGCCGGTGAA
GGTCGTCCGTGGAATCCCGGTGCCATCACCGGTGGTCGCGTGTGGGGGGATATCCCGGACAGCAGCGTCC
AGCCGGGAGCCGGAAATGGCGAACCGGTCACGGCAGAGGTGCTGGCACAGCGGCAGGCTGAAGAGGCCAT
CCGCCGTGAAACGGAACGCCGCGCAGATGAAATTGTCAGAAAAATGGCAGAGAACAAACCTGACCTGCCG
GATGGCAAAACAGAGCAGGCTGTCAGGGAAATTGCCGGGCAGGAGCGTGACCGGGCTGACATAACTGAAC
GGGAAGCCGCGCTGCCGGAGAGTGTGCTGCGTGAATCACAACGGGAGCAGGAAGCGGTCCGGGAGGTTGC
CCGGGAAAATCTGCTGCAGGAGCGTCTGCAGCAGATGGAGCGGGATATGGTTCATGACCTGCAGAAAGAG
AAAACCCTGGGCGGAGACTGA