SecReT4
Protein ID: 116050535
T4SS name [ID]Trb [240]
Gene symbol-
Locus tagPA14_31080
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T4SS(s) in this replicon]
Location [Strand]2703604..2704179 [-]
Productconjugal transfer protein
Component typeTraF
UniProt IDQ02N40
KEGG IDpau:PA14_31080
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 3.1e-55, Aligned region: 50..185
Protein Sequence: 191 a.a.     [Download]
>gi|116050535|ref|YP_790646.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MTAVSTGANTTGKAPRPRSRQRARIVLAGFAACGLAALAWASFVHPMPRLIYNPSDSVPVGWYRIAPPDA
PRVGSIVLTTLPPDAAALAAQRGYLPARVPLLKRVGAVAPQEVCVASGIVRIDGVPSAAALPADRWGRPL
PSWQQCRRLEPGELFLLSVTNPSSFDSRYFGPVAASAVIGVAHPIRLEARP
 
Nucleotide Sequence: 576 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c2704179-2703604 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGACCGCCGTTTCCACTGGCGCCAACACCACTGGAAAGGCGCCGCGTCCTCGCTCGCGCCAGCGCGCTC
GCATCGTGCTCGCGGGCTTCGCCGCCTGCGGCCTTGCTGCGCTGGCCTGGGCGTCCTTCGTGCATCCGAT
GCCGCGCCTGATCTACAACCCGTCCGACAGCGTTCCGGTGGGCTGGTATCGCATCGCGCCACCCGATGCG
CCGCGCGTCGGCTCCATCGTGCTGACCACGCTGCCGCCAGACGCCGCCGCGCTGGCCGCGCAGCGCGGCT
ACCTGCCGGCGCGCGTGCCGCTGCTCAAGCGCGTGGGCGCGGTCGCGCCGCAGGAGGTGTGCGTTGCCAG
CGGCATCGTCCGCATCGACGGCGTGCCTTCGGCCGCCGCGCTGCCCGCCGACCGTTGGGGCCGCCCGCTG
CCATCCTGGCAGCAGTGCCGCCGCCTTGAACCCGGCGAGCTTTTCCTGTTGAGCGTGACCAACCCGTCGT
CGTTCGACAGCCGGTATTTCGGCCCGGTTGCCGCATCCGCCGTGATCGGCGTCGCGCACCCGATCCGGCT
GGAGGCCCGCCCATGA