SecReT4
Protein ID: 116050546
T4SS name [ID]Trb [240]
Gene symbol-
Locus tagPA14_30960
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T4SS(s) in this replicon]
Location [Strand]2688485..2690485 [-]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDQ02N51
KEGG IDpau:PA14_30960
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2.1e-103, Aligned region: 111..558
TraG-D_C [PF12696], Evalue: 2.8e-31, Aligned region: 404..524
TrwB_AAD_bind [PF10412], Evalue: 5e-31, Aligned region: 172..539
Protein Sequence: 666 a.a.     [Download]
>gi|116050546|ref|YP_790635.1| traG gene product [Pseudomonas aeruginosa UCBPP-PA14]
MQGTNVLFGQIAVVFGIVIAGVWGATQWTAAALGYQLRLGSPWFDFLGTPIYYPWKLFEWWFSYGAYTPE
IFDTGGAIAGGSGMVAVAVAIAMSVWRSRQARLVTTYGSARWANAQDIRKAGLTQPVGVFLGQYDRQYLR
HEGPEHVLTFAPTRSGKGVGLVVPTLLSWPASAVIHDIKGENWQITAGWRSRFSHCLLFNPTDAKSAAYN
PLLEVRRGAHEVRDVQNIADILVDPEGALEKRNHWEKTSHALLVGAILHVLYAGEDKTLRGVANFLSDPA
SPFELTLHRMMTTPHLGDGPHPVVASAAREVLNKSDNERSGVLSTAMSFLGLYRDPTVAEVTSRCDWRIA
DLISAEHPVSLYLVVPPSDISRTKPLIRLILNQIGRRLTESLDGSDGIERRHKLLLMLDEFPALGRLDFF
ETALAFMAGYGIRSFLIAQSLNQIDKAYGQNHSILDNCHVRVTFATNDERTAKRISETLGTATELRAQRN
YAGHRLAPWLGHLMVSRQETARPLLTPGEVMQLPPDEAVVMVSSVAPIKARKLRYYADANFKRRVLPPPA
LADCQYADAPPLRADDWSGLAIPPTPTAPATASADGLGSADDGGPRRQPELSEAVAYDPELAAPAADLGL
LDDDDDLPLPLPRQLDPAMQRTARLASLDPNDGIEL
 
Nucleotide Sequence: 2001 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c2690485-2688485 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGCAAGGGACGAACGTGCTGTTCGGTCAGATCGCCGTGGTATTCGGCATCGTGATCGCCGGAGTGTGGG
GCGCCACACAATGGACAGCAGCAGCCCTTGGCTATCAGCTACGCCTTGGCTCGCCCTGGTTCGATTTTCT
TGGCACGCCGATCTACTACCCGTGGAAGCTGTTTGAGTGGTGGTTCTCTTACGGCGCCTATACCCCGGAA
ATCTTCGACACGGGCGGAGCCATCGCCGGTGGCAGCGGCATGGTCGCCGTGGCCGTCGCCATTGCCATGT
CGGTCTGGCGCTCGCGACAGGCACGCCTGGTCACGACCTACGGTTCGGCCCGTTGGGCGAATGCGCAGGA
CATTCGCAAGGCGGGCCTCACGCAGCCGGTCGGCGTGTTCCTCGGCCAGTACGATCGCCAGTACCTGCGC
CATGAAGGGCCAGAGCATGTTCTGACCTTCGCGCCCACACGCTCGGGCAAGGGCGTCGGCCTGGTGGTTC
CCACCTTGTTGAGCTGGCCGGCCTCGGCGGTCATCCACGACATCAAGGGGGAGAACTGGCAGATCACCGC
CGGCTGGCGCAGCCGTTTCAGCCACTGCCTGCTGTTCAACCCGACCGATGCAAAGTCGGCGGCCTACAAC
CCGCTGCTGGAGGTACGGCGCGGCGCGCATGAAGTGCGCGACGTGCAGAACATCGCGGACATTCTAGTCG
ATCCCGAAGGCGCGCTGGAGAAGCGCAACCATTGGGAGAAGACCTCGCACGCGCTGCTGGTCGGGGCGAT
CCTGCATGTGCTCTATGCGGGCGAGGACAAGACGCTGCGCGGCGTCGCCAACTTCCTCAGCGACCCGGCC
AGCCCCTTCGAGCTGACCTTGCACCGGATGATGACCACGCCCCACCTGGGCGATGGGCCGCATCCGGTGG
TGGCATCCGCTGCGCGCGAAGTGCTCAACAAGTCGGACAACGAGCGTTCTGGCGTCTTGAGCACCGCCAT
GTCGTTCCTCGGCCTGTACCGCGATCCCACGGTGGCCGAAGTCACGTCGCGCTGCGACTGGCGCATTGCC
GACCTCATATCCGCCGAGCATCCCGTATCGCTGTACCTGGTGGTGCCGCCTTCGGACATTTCGCGCACCA
AGCCGCTCATCCGCCTGATCCTCAACCAGATCGGGCGGCGCTTGACCGAATCGCTCGACGGCTCTGACGG
CATCGAACGCCGCCACAAGCTGCTGCTGATGCTCGATGAGTTTCCGGCCCTGGGCCGGCTCGACTTCTTC
GAGACGGCGCTCGCATTCATGGCGGGCTACGGCATCCGCAGCTTCTTGATTGCGCAGTCGCTCAACCAGA
TCGACAAAGCCTACGGCCAGAACCATTCGATTCTGGACAACTGCCATGTGCGCGTGACGTTCGCCACGAA
CGACGAGCGCACCGCCAAACGCATCTCCGAGACGCTGGGCACGGCCACCGAGCTGCGCGCACAGCGCAAC
TACGCGGGCCACCGGCTCGCGCCGTGGCTGGGGCACCTCATGGTGTCGCGCCAGGAGACGGCCCGCCCGC
TGCTGACACCGGGCGAAGTCATGCAGCTTCCGCCCGATGAGGCGGTGGTGATGGTGTCCAGCGTGGCGCC
GATCAAGGCCCGGAAGCTGCGCTATTACGCCGACGCCAATTTCAAGCGGCGCGTGTTGCCGCCGCCCGCG
CTGGCGGACTGCCAATACGCCGACGCGCCGCCGCTGCGCGCCGACGACTGGAGCGGGCTGGCAATCCCAC
CAACGCCCACCGCACCAGCCACGGCATCCGCCGATGGCCTCGGTTCCGCCGACGACGGCGGCCCACGCCG
TCAGCCCGAACTCTCCGAAGCCGTCGCCTACGACCCCGAGCTGGCCGCGCCCGCGGCCGACCTCGGTTTG
CTCGATGACGACGACGACCTGCCGCTTCCCCTTCCTCGCCAGCTTGATCCGGCCATGCAGCGCACGGCCC
GGCTGGCTTCCCTCGACCCCAACGACGGAATTGAGCTATGA