SecReT4
Protein ID: 116050548
T4SS name [ID]Trb [240]
Gene symbol-
Locus tagPA14_30940
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T4SS(s) in this replicon]
Location [Strand]2686957..2688027 [-]
Productconjugal transfer protein
Component typeTrbB
UniProt IDQ02N53
KEGG IDpau:PA14_30940
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.7e-81, Aligned region: 33..299
FtsK_SpoIIIE [PF01580], Evalue: 1.5e-06, Aligned region: 151..215
TrwB_AAD_bind [PF10412], Evalue: 1.8e-06, Aligned region: 151..192
Protein Sequence: 356 a.a.     [Download]
>gi|116050548|ref|YP_790633.1| trbB gene product [Pseudomonas aeruginosa UCBPP-PA14]
MSAVSQLPPEPRSSAAASLDRRIQMLRTAMGPLIATALEDPDVVEIMLNPDRTLWVDRLSSGRAPMGVEM
PEADGERIIRLVAAHVGAEVHRGQPLLSAELPETGERFEGILPPAAPGPAFALRKRAIGVIPLERYVVDG
MMTAAQAGFLVRAVRERQNVLIAGATSSGKTTLANALLAEIAATGDRVLVLEDTVELQCAARDHVPLRTR
AGVVSMTELVRSSMRLRPDRVVVGEVRGAEALDLIKVWGTGHPGGIATIHAGSALGALLRMEQLILEVAV
NPPRALIAEAVNVVIHIAGRGRKRRIESIARVVGSDGVGYQLADALETPFPELPLFPEAAPAAATSPSPD
QPGELP
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c2688027-2686957 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGAGCGCCGTTTCGCAGTTGCCACCCGAGCCACGCTCGTCCGCTGCGGCCTCGCTCGACCGGCGCATCC
AGATGCTGCGCACGGCGATGGGGCCGCTGATCGCCACTGCGCTCGAAGACCCCGACGTGGTGGAAATCAT
GCTCAACCCGGATCGTACCCTTTGGGTGGATCGGCTTTCGAGTGGGCGCGCGCCGATGGGCGTGGAGATG
CCCGAGGCCGATGGCGAGCGAATCATCCGCCTGGTCGCGGCCCACGTCGGCGCGGAGGTGCATCGCGGCC
AGCCGCTGCTATCGGCCGAGCTGCCCGAGACGGGCGAACGCTTCGAGGGCATCTTGCCGCCCGCCGCGCC
AGGGCCGGCCTTCGCGCTGCGCAAGCGCGCCATCGGCGTGATCCCGCTGGAGCGGTATGTCGTGGACGGA
ATGATGACCGCCGCCCAGGCGGGCTTTCTGGTGCGCGCCGTGCGCGAGCGTCAGAACGTCCTGATCGCCG
GGGCCACCAGCAGCGGCAAGACCACGCTCGCCAATGCCTTGCTCGCCGAAATCGCCGCCACGGGCGACCG
CGTGTTGGTGCTCGAAGACACGGTGGAGCTGCAATGCGCGGCCCGCGACCACGTTCCGCTGCGCACGCGC
GCGGGCGTGGTGTCGATGACCGAGCTGGTGCGCTCGTCCATGCGGCTGCGGCCGGATCGCGTGGTGGTTG
GCGAGGTGCGCGGCGCCGAGGCGCTGGATCTCATCAAGGTGTGGGGAACGGGCCACCCCGGCGGGATCGC
CACGATCCATGCCGGCTCCGCGTTGGGCGCGCTGCTGCGCATGGAGCAACTGATTCTCGAAGTGGCGGTG
AACCCGCCGCGTGCGCTGATCGCCGAGGCGGTCAACGTGGTGATCCACATCGCCGGACGCGGGCGCAAGC
GCCGCATCGAGAGCATCGCCCGCGTCGTCGGCTCCGACGGCGTGGGCTACCAACTGGCGGACGCGCTGGA
GACGCCGTTTCCCGAACTGCCGCTATTTCCCGAAGCCGCACCCGCTGCGGCGACTTCCCCGTCCCCTGAC
CAACCTGGAGAACTGCCATGA