SecReT4
Protein ID: 116050550
T4SS name [ID]Trb [240]
Gene symbol-
Locus tagPA14_30910
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T4SS(s) in this replicon]
Location [Strand]2683833..2686286 [-]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDQ02N55
KEGG IDpau:PA14_30910
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 4.8e-38, Aligned region: 442..711
CagE_TrbE_VirB [PF03135], Evalue: 3.1e-17, Aligned region: 294..388
DUF853 [PF05872], Evalue: 8.1e-08, Aligned region: 613..684
Protein Sequence: 817 a.a.     [Download]
>gi|116050550|ref|YP_790631.1| trbE gene product [Pseudomonas aeruginosa UCBPP-PA14]
MLNLAEYRQRPALLADWLPWAGLVAPGVVLNKDGSFQRTARFRGPDLDSATQGELIATSARLNNALRRLG
SGWALFIEAERRAAADYPHSEFPEPLSWLVDEERRATFEESGNHFESGYHLTLVYLPPEESRARAAKMLY
ENTPTNGVDWRERLQAFVAETDRVFDLLEGVMPEIAWLDDAQTLTYLHATISTRRYRVGVPEVPFHIDAL
LTDSPLVGGLAPMLGDRHLRVVSVRGFPTSTWPGILDDLNRLGFGYRWSTRFLCLDKSEAERELGRLRRQ
WFAKRKNVIALLRETIFQQESPLVDTDANNKAADADAALQELGSDQVAFGYLTATVTVMDADASAADEKL
RMVERVIQGRGFVTIPETLNAVDAWLSSLPGNAYANVRQPIVSTLNLAHMMPVSAVWAGPEKNDHLGGPP
LIVTRTDGATPFRLVTHIGDVGHTLVAGPTGMGKSVLLATLAMQFRRYRGSRIFAFDMGCSMRATILGLG
GEHYDLGTDGEIAFQPLARIDREGYRTWAAEWIEGRLLHEGVTVGPDEKAAIWSALGSLAGAPVEQRTMT
GLSVLLQSNVLRQALAPYVLGGAHGKLLDADHDRLGMADVQCFEMEELMHSKAAVMAVLHYLFARFDERF
DGAPTLLILDEAWLFLDDAVFAARIRQWLKTLRKKNVSVIFATQSLADIKDSSIAPAIIESCASRIFLPN
PQATEPQIRTIYEGFGLNRRQIEIVATAQPKRDYYYQSRLGNRLFDLDLGLATLAFAGASTPQDQRDMDR
VLLDAGTPGFAGAWLRHRGLDWAADLLPSFPGLAPVSFADQPLENLP
 
Nucleotide Sequence: 2454 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c2686286-2683833 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGCTGAACCTTGCCGAATACCGCCAGCGGCCCGCGCTGCTCGCCGACTGGCTGCCTTGGGCCGGACTGG
TCGCGCCAGGCGTCGTCTTGAACAAGGACGGCAGTTTCCAGCGCACGGCCCGGTTTCGCGGGCCTGACCT
CGACAGCGCCACGCAAGGCGAGCTGATCGCCACGTCGGCACGCTTGAACAACGCGCTGCGCCGGCTGGGT
TCGGGCTGGGCGCTGTTCATCGAGGCCGAGCGCCGCGCCGCTGCCGACTACCCGCACTCCGAGTTTCCCG
AGCCGCTGTCTTGGCTGGTGGACGAAGAACGCCGGGCCACCTTCGAGGAATCGGGCAACCACTTCGAGAG
CGGCTACCACCTGACGCTGGTGTACCTGCCGCCCGAGGAATCGCGCGCCCGTGCCGCCAAGATGCTCTAC
GAGAACACGCCGACGAATGGCGTGGACTGGCGCGAGCGGCTGCAAGCCTTCGTCGCGGAAACGGATCGGG
TCTTTGACCTGCTCGAAGGCGTGATGCCGGAAATCGCCTGGCTCGATGACGCGCAGACCCTGACCTACCT
GCACGCGACCATCTCGACGCGGCGCTACCGCGTGGGCGTACCCGAAGTGCCGTTCCACATCGACGCGCTG
CTGACCGATTCGCCGCTGGTCGGTGGCCTCGCGCCCATGCTGGGCGACCGGCACCTGCGCGTGGTGTCGG
TGCGTGGCTTTCCGACCTCGACCTGGCCGGGGATTCTGGACGACCTCAACCGCCTGGGATTTGGGTATCG
CTGGAGTACGCGCTTTCTGTGCCTCGACAAATCCGAGGCGGAACGGGAATTGGGGCGCTTGCGCCGCCAG
TGGTTCGCCAAGCGCAAGAACGTCATCGCGCTGTTGCGCGAAACGATCTTCCAGCAGGAAAGCCCGCTGG
TCGATACCGATGCGAACAACAAGGCGGCGGACGCGGATGCGGCCTTGCAGGAGCTGGGCAGCGATCAAGT
CGCCTTCGGCTACCTGACGGCGACCGTCACCGTCATGGACGCGGACGCCAGCGCAGCGGACGAGAAGCTG
CGCATGGTGGAGCGCGTCATTCAGGGGCGCGGGTTCGTCACCATCCCCGAAACGCTCAACGCCGTGGATG
CGTGGCTGTCCTCGCTTCCGGGCAACGCCTACGCCAATGTGCGCCAGCCCATCGTCTCGACGCTGAACCT
GGCGCACATGATGCCGGTGTCGGCGGTATGGGCCGGGCCGGAGAAGAACGACCACCTGGGCGGCCCGCCG
CTGATCGTCACGCGCACCGATGGCGCGACGCCGTTCCGGCTGGTGACGCACATCGGCGACGTGGGCCACA
CGCTGGTCGCCGGCCCGACCGGCATGGGCAAGTCGGTCTTGCTCGCCACGCTGGCGATGCAGTTTCGCCG
CTATCGCGGCTCGCGCATCTTCGCGTTCGACATGGGCTGCTCGATGCGCGCCACGATCCTCGGGCTGGGC
GGCGAGCACTACGACCTGGGCACGGATGGCGAAATCGCTTTCCAGCCGCTTGCCCGTATCGACCGTGAAG
GCTACCGCACCTGGGCGGCCGAATGGATCGAAGGCCGCTTGCTGCATGAAGGCGTGACGGTCGGCCCCGA
TGAGAAGGCCGCCATCTGGTCGGCGCTGGGGAGCCTGGCCGGTGCGCCGGTGGAGCAGCGCACGATGACC
GGGCTTTCCGTGCTGTTGCAGAGCAATGTGCTGCGCCAGGCGCTCGCGCCCTATGTGCTGGGCGGCGCGC
ACGGCAAGCTGCTGGACGCCGATCACGACCGGCTGGGCATGGCCGACGTGCAGTGCTTCGAGATGGAGGA
GCTGATGCACAGCAAGGCCGCCGTCATGGCCGTGCTGCATTACCTCTTTGCGCGTTTCGATGAACGCTTT
GACGGTGCGCCCACGCTGCTGATCCTCGATGAAGCGTGGCTGTTCCTCGATGACGCGGTGTTCGCGGCGC
GCATCCGCCAGTGGCTCAAGACGCTGCGCAAGAAGAACGTCAGCGTCATCTTCGCCACGCAGTCGCTTGC
GGACATCAAGGATTCGAGCATCGCGCCCGCGATCATCGAAAGCTGCGCAAGCCGCATCTTCCTGCCGAAC
CCGCAGGCGACCGAGCCGCAGATTCGCACGATCTACGAGGGCTTCGGCCTCAACAGGCGGCAGATCGAGA
TCGTCGCCACCGCGCAGCCCAAGCGCGACTACTACTACCAATCCCGCCTCGGCAACCGCCTGTTCGACCT
CGACCTGGGACTGGCGACGCTGGCCTTCGCGGGCGCTTCCACGCCGCAAGACCAGCGCGACATGGATCGC
GTGCTGCTGGACGCCGGCACGCCCGGCTTCGCGGGCGCATGGCTGCGCCATCGCGGCCTCGATTGGGCGG
CTGACCTGCTGCCCTCGTTCCCCGGCCTCGCGCCGGTTTCCTTCGCTGACCAACCACTGGAGAACCTGCC
ATGA