SecReT4
Protein ID: 116050554
T4SS name [ID]Trb [240]
Gene symbol-
Locus tagPA14_30870
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T4SS(s) in this replicon]
Location [Strand]2680695..2681399 [-]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDQ02N59
KEGG IDpau:PA14_30870
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.1e-61, Aligned region: 23..225
Protein Sequence: 234 a.a.     [Download]
>gi|116050554|ref|YP_790627.1| trbF gene product [Pseudomonas aeruginosa UCBPP-PA14]
MRFKKPQVRYADTPQPATPYQAAGQVWDDRIGSPRVQAKNWRLMAFGCLTLALLMAGGLVWRSAQSIVTP
YVVEVDNAGQVRAVGEAATPYRPSDAQTAHHIARFVTLVRSLSIDPIVVRQNWLDAYDYTTDKGAAVLND
YARVNDPFARIGKESVTVQITSVVRASDTSFNVRWTERRYVNGAAAGLERWTAVVSIVLQPPRTEERLRK
NPLGIYVNGLSWSRELDSSEGAKP
 
Nucleotide Sequence: 705 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c2681399-2680695 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGCGATTCAAGAAACCGCAGGTGCGCTACGCCGACACGCCGCAGCCTGCCACGCCGTACCAAGCTGCCG
GCCAGGTGTGGGACGACCGTATCGGCTCGCCGCGCGTGCAGGCGAAGAACTGGCGCTTGATGGCGTTCGG
GTGCCTGACGCTCGCGCTGCTGATGGCCGGCGGCCTGGTGTGGCGCTCGGCGCAGTCCATCGTGACGCCC
TATGTGGTGGAGGTGGACAACGCGGGCCAGGTGCGCGCTGTGGGCGAAGCCGCCACGCCGTACCGCCCCA
GCGATGCACAGACGGCGCACCACATTGCGCGCTTCGTGACGCTGGTGCGCTCGCTGTCCATCGACCCCAT
CGTCGTCCGCCAAAACTGGCTGGACGCCTACGACTACACGACCGACAAGGGCGCGGCCGTGCTCAACGAC
TACGCGCGGGTCAACGACCCGTTCGCACGCATCGGCAAGGAGTCGGTGACGGTGCAGATCACCAGCGTCG
TGCGCGCCAGCGACACGTCTTTCAACGTGCGCTGGACGGAACGGCGCTACGTCAACGGCGCCGCGGCGGG
CCTGGAGCGGTGGACGGCGGTGGTGTCCATCGTGCTCCAGCCACCGCGCACCGAAGAACGCCTGCGCAAG
AACCCGCTGGGCATCTACGTCAACGGCCTGTCGTGGAGCCGTGAACTGGATTCTTCCGAAGGAGCAAAGC
CATGA