SecReT4
Protein ID: 116050556
T4SS name [ID]Trb [240]
Gene symbol-
Locus tagPA14_30850
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T4SS(s) in this replicon]
Location [Strand]2678435..2679706 [-]
ProductTrbI-like protein
Component typeTrbI
UniProt IDQ02N61
KEGG IDpau:PA14_30850
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 9.9e-58, Aligned region: 227..409
Protein Sequence: 423 a.a.     [Download]
>gi|116050556|ref|YP_790625.1| trbI gene product [Pseudomonas aeruginosa UCBPP-PA14]
MSQDDTPDRAAPQVGKVAPEAVALRAQPRPVTRLNRRTLAMFMGGLSVAVLGATIWSLQPHRRGAGEQTE
LYNVDRVSKSEGLDGLPADYSKLPQKVPELGPPLPGDLGPAIVASQQPVTPTYVPPGHDPEDALRKEADA
AAASSVFFRSGQQGNAAAPATAQAAAAATGNALAGFDPLAAGPASMAAQPADPTATQNRQDQKEAFLKGG
STETRNSGNLQMPASPYQVMAGTVIAAALVTGIKSDLPGDVIGTVTEPVYDSATGKFLLIPQGSRILGKY
NSQVSYGQSRVQVVWNRIILPDTSSLTIDNLVGTDPAGYSGLEDGVDYHWGRIVAGAALTTLLGVGAELA
APENRQDGNRIVIAGRDSAQDSINQVGQEMTRRNMNIQPTLTERPGLPVRIIVNRDLVLRPYQPMFFNRG
AMR
 
Nucleotide Sequence: 1272 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c2679706-2678435 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGAGCCAGGACGACACCCCCGACCGTGCCGCGCCGCAGGTGGGCAAGGTCGCGCCCGAGGCGGTGGCGC
TGCGCGCGCAGCCGCGCCCGGTCACGCGCCTTAACCGGCGCACGCTGGCGATGTTCATGGGCGGCCTGTC
GGTCGCCGTGCTGGGTGCGACCATCTGGTCATTGCAGCCGCACCGGCGCGGCGCGGGCGAGCAGACCGAG
CTTTACAACGTCGATCGCGTGTCCAAGTCCGAAGGGCTGGACGGCCTGCCGGCCGACTACTCGAAGCTGC
CGCAGAAGGTGCCCGAGCTGGGGCCGCCGCTGCCGGGCGACCTTGGCCCCGCCATCGTGGCCTCGCAGCA
GCCGGTCACGCCGACCTATGTGCCGCCCGGCCACGACCCCGAGGACGCCTTGCGCAAGGAGGCTGACGCC
GCTGCGGCCTCATCGGTGTTCTTCCGCTCGGGCCAGCAGGGCAATGCCGCAGCGCCAGCCACGGCCCAAG
CCGCTGCGGCTGCGACTGGCAACGCCTTGGCAGGCTTCGACCCGCTGGCGGCTGGGCCTGCCTCGATGGC
GGCCCAGCCTGCCGACCCGACTGCCACGCAGAACCGGCAAGACCAGAAGGAGGCATTCCTGAAAGGCGGT
TCTACGGAAACCCGCAATTCCGGCAACCTGCAAATGCCGGCCTCGCCGTATCAAGTCATGGCCGGGACAG
TGATCGCGGCTGCGTTGGTGACGGGCATCAAGTCCGACTTGCCGGGCGACGTGATCGGCACGGTGACAGA
GCCGGTCTATGACTCGGCCACGGGCAAGTTCCTGCTGATCCCGCAGGGATCGCGCATCCTCGGCAAATAC
AACAGCCAGGTCAGTTACGGGCAGAGTCGCGTGCAGGTGGTGTGGAACCGGATCATCCTGCCAGACACGT
CTTCGCTGACCATCGACAACCTGGTGGGTACCGACCCGGCCGGCTACTCCGGCCTCGAAGATGGCGTGGA
CTACCACTGGGGCCGCATCGTCGCCGGTGCGGCACTGACGACGCTGCTGGGCGTAGGTGCCGAGTTGGCC
GCGCCCGAGAACCGCCAAGACGGCAACCGCATCGTGATCGCGGGGCGCGACAGCGCCCAAGACAGCATCA
ATCAGGTTGGACAGGAGATGACCCGGCGCAACATGAACATCCAGCCGACGTTGACCGAACGGCCGGGCCT
GCCGGTGCGGATCATCGTCAACCGCGACTTGGTGCTGCGACCGTACCAGCCGATGTTCTTCAACCGGGGA
GCGATGCGATGA