SecReT4
Protein ID: 118614689
T4SS name [ID]Tra_F [590]
Gene symbol-
Locus tagP99018ORF_061
StrainPhotobacterium damselae subsp. piscicida plasmid pP99-018 (NC_008612)
Repliconplasmid pP99-018 [GenBank: NC_008612] [Browse all T4SS(s) in this replicon]
Location [Strand]43032..44348 [+]
Productsex pilus assembly protein
Component typeTraB_F
UniProt IDA0PB03
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.2e-50, Aligned region: 225..427
Protein Sequence: 438 a.a.     [Download]
>gi|118614689|ref|YP_908472.1| sex pilus assembly protein [Photobacterium damselae subsp. piscicida]
MIKRFWTQLDPNKKRWVSIAGGVFVLFAVVTMFSGEPKKEEKRGRQETIKHVLTDKNTREIGIDSLSADV
KMVSRENSDLKKELERVKKELEETKTTAGKSSDVGREMTRLRQDLDRLTQKNMELAKKVETGAAGGKTSS
SSEDARADVNGASGGDGQFMEKKLDYKDPASFFRDAPLPDSKGGAPATGKGDGRDATKPGIQIVSYSQKA
PEVEEKDNKDDESIYLPSGSILTGVLINGMDAPTSQGARRDPFPSTLRIQKEAILPNRFRADVRECFLIV
SGYGDLSSERAYLRGETFSCVRDDGGVIEAKLDSYAVGEDGKAGVRGRVVSKQGQIIAKSLMAGFLGGVS
EAFDVNPVPVVSTNPGSNTQYQSVFSDQMLQGAAVKGASKALDRIAQFYIDMAEGIFPVIEVDAGRQVDI
IVTKGTKLQIRSTGGTKK
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|118614628|ref|NC_008612.1|:43032-44348 Photobacterium damselae subsp. piscicida plasmid pP99-018, complete sequence
ATGATTAAGCGATTTTGGACACAGTTAGACCCCAACAAGAAGCGTTGGGTGTCTATCGCTGGCGGCGTCT
TCGTTCTTTTTGCGGTCGTGACAATGTTCTCTGGTGAACCCAAGAAAGAAGAGAAGCGCGGTCGCCAAGA
AACCATCAAGCACGTTCTCACAGACAAAAACACCCGTGAGATCGGGATAGATTCGTTGTCTGCCGATGTG
AAGATGGTGTCTCGTGAAAACTCCGACCTGAAAAAGGAGCTGGAACGAGTCAAGAAAGAGCTGGAGGAAA
CCAAAACCACTGCCGGGAAATCCAGTGATGTTGGCCGTGAGATGACCCGCCTTCGTCAAGATTTGGACCG
CCTGACCCAGAAGAACATGGAATTGGCTAAGAAAGTCGAAACCGGCGCTGCTGGTGGAAAAACATCCTCT
TCATCAGAGGATGCCAGAGCCGATGTTAATGGTGCATCTGGTGGTGATGGTCAGTTCATGGAGAAAAAGC
TCGACTACAAAGATCCAGCATCCTTTTTTCGGGACGCACCGCTTCCTGACTCGAAGGGTGGGGCTCCTGC
AACTGGCAAGGGAGACGGTCGTGATGCAACTAAACCAGGCATCCAAATAGTGAGCTACTCGCAGAAAGCG
CCAGAAGTTGAAGAGAAGGACAACAAGGATGATGAGTCTATCTACCTACCTTCTGGCTCCATCCTGACAG
GGGTGCTCATCAACGGTATGGACGCACCAACATCTCAAGGTGCTCGTCGAGATCCGTTCCCTTCGACCCT
CAGGATTCAGAAAGAGGCTATTTTGCCTAACCGCTTCCGTGCGGATGTTCGTGAGTGCTTCCTGATTGTT
TCAGGCTATGGAGATCTCAGTTCAGAGCGAGCGTACCTGCGTGGCGAGACCTTCTCGTGCGTTCGGGATG
ATGGGGGGGTCATAGAAGCGAAGCTGGATTCCTATGCAGTGGGTGAAGACGGTAAGGCCGGTGTCCGTGG
TCGCGTCGTATCGAAGCAGGGGCAAATCATCGCCAAGAGCTTGATGGCAGGCTTCCTTGGTGGCGTTTCC
GAAGCCTTTGACGTCAATCCTGTGCCGGTCGTCAGCACTAACCCTGGCTCAAATACCCAGTACCAGTCTG
TGTTCTCCGACCAGATGTTGCAGGGAGCAGCAGTGAAGGGGGCCAGTAAGGCGCTAGATCGCATCGCTCA
GTTCTATATCGACATGGCCGAAGGCATCTTCCCCGTTATCGAGGTCGATGCTGGCCGTCAGGTAGACATC
ATCGTGACCAAAGGAACCAAGCTACAAATTCGTTCCACCGGGGGAACCAAGAAATGA