SecReT4
Protein ID: 120611414
T4SS name [ID]Tfc [726]
Gene symbol-
Locus tagAave_2750
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]3022694..3024319 [-]
Producthypothetical protein
Component typeTfc19
UniProt IDA1TQT0
KEGG IDaav:Aave_2750
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 1.5e-110, Aligned region: 8..519
Protein Sequence: 541 a.a.     [Download]
>gi|120611414|ref|YP_971092.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MQLDSYLELFTTMYGWAFANIMGEIITGTGLAALPFALIVFNAWREAKEQGQGFLGVLGLLESVQTRLYT
ALFVMTVCFATTPITSLHNVNLSYTPTRSLDNSEPQPVSLKSGTRSSYDVAMADAVSGAFSKAGNLSYVP
AWWYAVMGISSGINSAFRAGLSSSSRDIRVIEDMARMATIEDPGLLHDLQRFYSECFIPARSQYLAMDKA
TISTAGKAILAEGSSYGPTDVDWVGSQFFRTEKGFYSTIRSYNPVPGWPIDFARDTDYIQTPAPEGTPEA
GYQNPDWGRPTCKEWWESGTMGLREKLITNTSAWRGLSQKVQNTLSFKSADEAKDSVARLGFEKANPVFV
SPERIMGDEYGVGTNTWRTVTGAISTWGVANKALDASLAMVPLLNALPMVQALVLMALYMFLPMIVFLSG
YDLKVAFYGTLAIFTVKFWSVLWFVARWIDAHLIDAMYPGFSGSAMMQEITQSFSSGQPQIYKRMLLNTL
LMIMFIGLPLFWSALLGWIGFHMGDQFMLSRGNDMALGAGAGSKSIVSRRR
 
Nucleotide Sequence: 1626 bp     [Download]
>gi|120608714|ref|NC_008752.1|:c3024319-3022694 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGCAGCTCGACAGCTACCTGGAGCTCTTCACCACCATGTATGGTTGGGCCTTCGCCAACATCATGGGCG
AGATCATCACCGGCACGGGCCTGGCCGCCCTGCCCTTCGCCCTCATCGTATTCAACGCCTGGCGTGAGGC
CAAGGAGCAAGGCCAAGGCTTCCTTGGCGTGCTCGGGCTGCTGGAGTCGGTTCAAACGCGCCTGTACACC
GCGCTCTTCGTGATGACCGTCTGCTTCGCGACCACGCCGATCACCTCGCTGCACAACGTCAACCTGAGCT
ACACCCCGACGCGCTCGCTTGACAACAGCGAGCCTCAACCGGTGTCGCTCAAGAGCGGCACGCGCTCGAG
CTACGACGTCGCAATGGCCGACGCCGTGTCGGGTGCGTTCAGCAAGGCAGGCAACCTCAGCTACGTGCCG
GCCTGGTGGTACGCAGTCATGGGCATCTCGTCGGGCATCAACAGCGCGTTTCGCGCCGGATTGAGCAGCT
CCTCGCGCGACATCCGCGTCATCGAAGACATGGCGCGGATGGCGACGATCGAGGACCCGGGCCTGCTGCA
CGATCTGCAGCGCTTCTACTCGGAATGCTTCATCCCTGCCCGCAGCCAGTACCTGGCCATGGACAAGGCG
ACGATTTCCACGGCCGGCAAAGCCATCCTGGCCGAAGGCAGCAGCTACGGGCCCACCGACGTGGACTGGG
TGGGGAGCCAATTCTTCCGGACCGAGAAGGGCTTCTACAGCACCATCCGCTCGTACAACCCGGTGCCGGG
CTGGCCGATCGATTTCGCCCGGGACACGGACTACATCCAGACGCCGGCACCGGAGGGCACGCCCGAGGCG
GGATACCAGAATCCGGACTGGGGACGGCCGACCTGCAAGGAGTGGTGGGAGTCGGGCACGATGGGCCTAC
GCGAGAAGCTCATCACCAACACCTCGGCCTGGCGAGGCCTCTCGCAGAAGGTCCAGAACACCCTTTCGTT
CAAGTCGGCGGACGAGGCCAAGGACAGCGTGGCCCGGCTCGGCTTCGAGAAGGCCAATCCGGTGTTCGTG
AGCCCGGAGCGGATCATGGGCGACGAGTACGGTGTGGGCACCAACACGTGGCGGACCGTGACTGGAGCGA
TCAGCACATGGGGCGTCGCCAACAAAGCGCTGGACGCCTCGCTCGCCATGGTCCCGCTTTTGAATGCCCT
GCCCATGGTCCAGGCCCTGGTGCTCATGGCCCTCTACATGTTTCTGCCGATGATCGTCTTCCTGAGCGGC
TACGACCTCAAGGTGGCCTTCTACGGCACCCTGGCAATCTTCACGGTCAAGTTCTGGTCGGTACTCTGGT
TCGTCGCGCGCTGGATCGACGCCCACCTCATCGATGCTATGTACCCCGGTTTCAGCGGCTCCGCGATGAT
GCAGGAGATCACGCAGAGCTTCAGTTCCGGCCAGCCGCAGATTTACAAGCGGATGCTGCTGAACACCCTG
CTGATGATCATGTTTATTGGACTGCCACTCTTCTGGTCAGCGCTGCTTGGATGGATCGGGTTCCATATGG
GGGACCAATTCATGCTGAGCAGAGGAAATGACATGGCACTCGGTGCCGGAGCAGGCTCCAAATCGATCGT
TTCTAGGCGCCGTTAG