SecReT4
Protein ID: 120611417
T4SS name [ID]Tfc [726]
Gene symbol-
Locus tagAave_2753
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]3026177..3027472 [-]
Producthypothetical protein
Component typeTfc23
UniProt IDA1TQT3
KEGG IDaav:Aave_2753
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 1.6e-112, Aligned region: 38..422
Protein Sequence: 431 a.a.     [Download]
>gi|120611417|ref|YP_971095.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MTFTRIATALRKAVALAAASSVLTLGMPMPAQAITTPGVIAGTAAGLASCLSYRVEGVCFFLRCKLAFCW
IETSIKISHYVPDVVVSTYNDPIQHPWTDIGKIVATAMNGASSTVYSSLFDSSAGGLNTPSAMANFKGAD
AIGNPAGMLASIIANGGQVTMPTTLVIPGPFELAQFPSQLPSIAASWANVPSSIASTVASDARKMLDAPG
QLLGSLQTIMRGVQGVSQVMEIAETVNLVYGASNTFMQIGSMITGSTGGTMLLCPGSATLFGLHFQSELD
APFWRGVIPVEMLYPDSWVPGIGEVGSGYTQTWGPTFPRTGEIIQAHPVKASAVLAERVKSIIYRSAQPH
IYAKVELQGTKDYVYFNEDKAQWQMLHPNVWTSCEQFGTNDSLSLTSWGDAQTDSADGYSWNLWKHYVCC
QRRGAFLFSVP
 
Nucleotide Sequence: 1296 bp     [Download]
>gi|120608714|ref|NC_008752.1|:c3027472-3026177 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGACGTTCACCCGCATCGCCACCGCCCTGCGCAAGGCGGTCGCGCTCGCGGCCGCGAGCTCGGTGCTGA
CGCTCGGCATGCCCATGCCGGCGCAAGCCATCACCACGCCTGGCGTGATCGCCGGCACCGCGGCCGGCCT
CGCCTCGTGCCTGTCCTACCGCGTGGAAGGCGTGTGCTTCTTTCTGCGCTGCAAGCTCGCCTTCTGCTGG
ATCGAGACCTCGATCAAGATCAGCCACTACGTGCCGGACGTCGTGGTGAGCACGTACAACGACCCCATCC
AGCACCCGTGGACCGACATCGGGAAGATTGTGGCCACGGCCATGAACGGAGCGAGTTCCACCGTCTACAG
CAGCCTTTTCGACTCGTCCGCCGGCGGGCTCAACACGCCTTCGGCCATGGCGAACTTCAAGGGCGCCGAT
GCGATCGGAAATCCCGCTGGCATGCTGGCCAGCATCATCGCGAACGGCGGGCAGGTGACGATGCCCACCA
CCCTCGTCATCCCGGGCCCGTTCGAGCTTGCCCAGTTCCCCAGTCAGCTTCCCAGCATCGCTGCCAGCTG
GGCCAACGTGCCCTCCTCGATCGCGAGCACCGTGGCGTCCGATGCCCGCAAGATGCTCGACGCCCCGGGC
CAGCTGCTCGGTAGCCTGCAGACGATCATGCGAGGTGTGCAGGGAGTGAGCCAGGTGATGGAGATCGCAG
AGACCGTGAACCTGGTCTACGGCGCCTCCAACACCTTCATGCAGATCGGCAGCATGATCACCGGCTCCAC
CGGCGGCACCATGCTGCTGTGCCCGGGCAGCGCCACGCTGTTCGGGCTGCACTTCCAATCGGAGCTCGAT
GCGCCCTTCTGGCGTGGTGTTATCCCTGTCGAAATGCTCTACCCAGATTCCTGGGTTCCCGGCATAGGCG
AAGTCGGCAGCGGCTACACGCAGACCTGGGGGCCGACGTTCCCGCGCACCGGCGAAATCATCCAGGCCCA
TCCCGTGAAGGCCTCGGCGGTCCTGGCCGAGCGCGTCAAGTCGATCATCTACCGCTCCGCCCAACCGCAC
ATCTACGCCAAGGTGGAACTGCAGGGCACCAAAGACTACGTCTACTTCAACGAAGACAAGGCGCAGTGGC
AGATGCTCCATCCGAACGTCTGGACCAGCTGCGAGCAGTTCGGCACCAACGACTCGCTCTCCCTCACCTC
CTGGGGCGATGCCCAGACCGATTCCGCCGATGGCTATTCCTGGAACCTGTGGAAGCACTACGTGTGCTGC
CAGCGCCGCGGCGCGTTCCTGTTTTCTGTACCGTAA