SecReT4
Protein ID: 120611418
T4SS name [ID]Tfc [726]
Gene symbol-
Locus tagAave_2754
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]3027469..3027903 [-]
Producthypothetical protein
Component typeTfc24
UniProt IDA1TQT4
KEGG IDaav:Aave_2754
PDB IDNA
Domain hit(s) vs Pfam DUF1525 [PF07511], Evalue: 1.9e-31, Aligned region: 36..140
Protein Sequence: 144 a.a.     [Download]
>gi|120611418|ref|YP_971096.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MKRRILIAAAVCSAGAVWAQGAPSVTTVEVFANSATNLSTPSQPPYVLQVYRVDALAQLGRQFSARLPAN
EAQARAYMQQQEAQIRARYKDQITQAANGMSLAMHYRLTRLPAVVVNREAVIYGVADVQHAVGLYQQSKA
RGAR
 
Nucleotide Sequence: 435 bp     [Download]
>gi|120608714|ref|NC_008752.1|:c3027903-3027469 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGAAGCGCAGGATCCTCATCGCCGCGGCCGTGTGTTCCGCCGGCGCCGTGTGGGCCCAGGGTGCTCCAT
CGGTCACCACGGTGGAGGTGTTCGCCAACAGCGCAACCAACCTCTCCACGCCATCCCAACCACCCTACGT
GCTCCAGGTGTATCGCGTCGACGCGCTCGCCCAGCTGGGCCGGCAGTTCAGCGCCCGGCTGCCGGCGAAC
GAGGCCCAGGCCCGGGCATACATGCAACAGCAGGAGGCGCAGATCCGCGCCCGTTACAAGGACCAGATCA
CGCAGGCGGCCAATGGCATGTCACTCGCTATGCACTACCGGCTGACGCGCCTGCCGGCCGTGGTGGTCAA
CCGCGAAGCCGTGATTTACGGTGTGGCCGACGTGCAGCACGCGGTCGGCCTGTACCAGCAATCCAAGGCG
AGGGGCGCCCGATGA