SecReT4
Protein ID: 120611419
T4SS name [ID]Tfc [726]
Gene symbol-
Locus tagAave_2755
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]3027900..3030794 [-]
Producthypothetical protein
Component typeTfc16
UniProt IDA1TQT5
KEGG IDaav:Aave_2755
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 4.3e-56, Aligned region: 46..321
AAA_10 [PF12846], Evalue: 2.9e-33, Aligned region: 515..886
FtsK_SpoIIIE [PF01580], Evalue: 2.7e-05, Aligned region: 509..558
Protein Sequence: 964 a.a.     [Download]
>gi|120611419|ref|YP_971097.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MKKWFDVLLGRSSSASGERAAPSPAASGAPGKPMTLADRRRMAARPPSFTELLPYVCYSPAEQVFAMRDG
ATLGAMFELSPVATEAQPLTYLQERARKVQEALQAIPEAEGSPWIVQFFLSDDRNVEILNQQLHDYILSQ
HKDNPRRAQEVISSEYTQSVLAEMRKHLDQVSRPQGLFTDTLVTGQVWRGQQRRVRCCIYRKFTGLANEP
AEPIKQMEGAATTLFATFTEAGVTARRCNGRDFYEWLLPFFNRDVPWAPTPGELLQKAPYPGEMPEGMFD
WDLAESLSLSQPRADVDAGLFEFDGVPVKALTLQNLRGQPAIGHFSAELTSGKESYARFDRLPPGSMLSM
TVTVTPQHLVERKVERIRDKSRAKTAIAMEAHAECERVLQRMVNGDKLYPMFVTLYLTGRDRTELDAAIS
EVNALLVPTGMRFVDPRHDLVPLDSFVRALPFNFDPDFDQRYMLRSRLTFASHIAAIAPVYGRSRGTPHP
GMWYWNRGGEPLFMDPLNKLDRKKNAHMLVLGPTGAGKSATLNYQAMFSMAVHRPRLVIVDAGMSFDLLV
KDMAAKGLSVHRVRLTMDCEESLPPFVHGARLLQDKEIMDSFHAAENQAKRNAGLSVDEAADGGKSSKIM
ETVDTVIEAQAADTDSDDDGVDEKRDLLGEMLIAAIMMITGGEPAEVARMSRADRYLVTRAIIKAALQAS
KDGHKHPLTQDVAIALMAMHNDPTLSTHRQARAEEMGQSMMTFTQGLRGKLFNRYGGDWPDADVTLVEMG
TLTKDGYGDALAVAYTSLIDSVQSRGEQFQDQGRPLIMLTDEGHLITTNDLLGPKVAKATKMWRKLNIWF
WLATQNLKDFPDSMERVLSMCEFWMLLTMDKSEIEEVARFRNLTPEQRHMMESAVKEPPKYTEGVLISAT
GQWLFRNVPPAVPIALAMTEGHEKAHRRRLMDAHGCTELDAAYMVAEKLAEARA
 
Nucleotide Sequence: 2895 bp     [Download]
>gi|120608714|ref|NC_008752.1|:c3030794-3027900 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGAAGAAGTGGTTCGACGTGCTGCTTGGCCGCTCCTCGTCGGCAAGCGGGGAGCGCGCTGCGCCGTCGC
CCGCAGCCTCCGGCGCGCCTGGCAAGCCGATGACCTTAGCGGACCGTCGCAGGATGGCGGCCAGGCCGCC
GTCGTTCACCGAGCTTCTGCCGTACGTTTGCTATTCGCCGGCGGAGCAGGTGTTTGCCATGCGCGATGGC
GCCACCCTGGGCGCCATGTTCGAGCTCAGTCCGGTGGCTACCGAGGCGCAGCCGCTCACCTACCTGCAGG
AGCGCGCCCGCAAGGTGCAGGAGGCCCTGCAGGCGATCCCCGAGGCCGAAGGCTCGCCCTGGATCGTGCA
GTTCTTCCTGAGCGACGACCGCAACGTCGAGATCCTGAACCAGCAGCTGCACGACTACATCCTGTCCCAG
CACAAGGACAACCCGCGCCGGGCCCAGGAGGTGATTTCCTCCGAGTACACCCAGTCCGTCCTGGCCGAGA
TGCGCAAGCACCTGGACCAGGTGTCCCGCCCGCAGGGCCTGTTCACCGACACCCTCGTCACCGGCCAGGT
CTGGCGGGGCCAGCAGCGCCGCGTGCGCTGCTGCATCTACCGCAAGTTCACCGGCCTGGCGAACGAGCCA
GCCGAGCCGATCAAGCAGATGGAGGGCGCCGCCACGACGTTGTTCGCGACGTTCACCGAGGCGGGCGTCA
CCGCGCGCCGCTGCAACGGCCGAGACTTCTACGAATGGCTCCTGCCCTTCTTCAATCGCGATGTTCCGTG
GGCACCCACGCCGGGTGAGCTGTTGCAGAAGGCGCCCTACCCGGGCGAGATGCCTGAAGGCATGTTCGAC
TGGGACCTGGCCGAGTCGCTGTCGCTCAGCCAGCCGCGTGCGGACGTCGATGCCGGTCTCTTCGAGTTCG
ACGGCGTGCCCGTGAAGGCTCTGACGCTGCAGAACCTGCGTGGCCAGCCCGCCATCGGGCACTTCTCGGC
GGAGCTCACCAGCGGCAAGGAGAGCTATGCGCGCTTCGACCGCCTCCCACCCGGATCCATGCTGTCGATG
ACCGTCACCGTGACGCCGCAGCACCTGGTGGAGCGGAAGGTGGAACGCATCCGCGACAAGTCGCGGGCGA
AGACCGCCATCGCCATGGAGGCGCACGCCGAGTGCGAGCGGGTGCTCCAGCGCATGGTGAACGGCGACAA
GCTCTACCCGATGTTCGTCACGCTATACCTCACAGGCCGCGATCGGACCGAGCTCGACGCCGCGATCTCG
GAGGTGAATGCGCTGCTCGTTCCCACCGGAATGCGCTTCGTCGATCCGCGCCATGATCTGGTGCCGCTCG
ACAGCTTCGTGCGCGCGCTGCCCTTCAACTTCGATCCGGACTTCGACCAGCGGTACATGCTGCGCTCGCG
TCTCACGTTCGCGAGCCACATCGCTGCGATCGCGCCCGTGTATGGCCGCTCCCGCGGCACGCCGCACCCC
GGCATGTGGTACTGGAACCGCGGCGGCGAGCCGTTGTTCATGGACCCGCTCAACAAGCTCGACCGCAAGA
AGAACGCGCATATGTTGGTGCTCGGGCCCACGGGCGCGGGCAAGTCGGCGACGCTGAACTACCAGGCCAT
GTTCTCTATGGCCGTCCACCGACCGCGCCTGGTGATCGTCGACGCCGGCATGTCCTTCGACCTGCTGGTG
AAGGACATGGCCGCCAAGGGCCTGTCGGTTCACCGGGTGCGGCTGACCATGGACTGTGAGGAGTCCTTGC
CGCCGTTCGTGCACGGTGCCCGGCTGCTTCAGGACAAGGAGATCATGGATTCCTTCCATGCCGCAGAGAA
CCAGGCGAAGCGCAATGCGGGCCTGAGCGTGGACGAGGCGGCGGACGGCGGCAAGAGCTCGAAGATCATG
GAGACTGTCGATACCGTGATCGAGGCCCAGGCAGCAGACACGGATAGCGACGACGACGGCGTTGATGAGA
AGCGAGATCTGTTGGGCGAGATGCTGATCGCCGCCATCATGATGATCACCGGAGGCGAGCCGGCAGAGGT
CGCACGCATGAGCCGTGCCGACCGCTACCTCGTGACCCGGGCCATCATCAAGGCGGCGCTGCAGGCATCC
AAGGACGGCCACAAGCATCCGCTGACCCAGGACGTCGCCATCGCGCTCATGGCGATGCACAACGACCCGA
CCCTCTCGACGCACCGCCAGGCGCGCGCGGAAGAAATGGGGCAGTCGATGATGACGTTCACCCAGGGACT
GCGTGGCAAGCTCTTCAACCGCTACGGCGGCGACTGGCCTGACGCCGACGTGACCCTGGTGGAGATGGGC
ACTCTCACGAAGGATGGCTATGGAGATGCGCTCGCCGTCGCCTACACCAGCCTGATCGATTCGGTCCAGT
CGCGCGGCGAGCAGTTCCAGGACCAGGGCCGGCCGCTCATCATGCTGACCGACGAGGGCCACCTGATCAC
CACCAACGATCTGCTGGGCCCGAAGGTGGCCAAGGCCACCAAGATGTGGCGCAAGCTGAACATCTGGTTC
TGGCTCGCTACGCAGAACCTGAAGGACTTCCCGGACAGCATGGAGCGCGTGCTATCGATGTGCGAATTCT
GGATGCTGCTCACAATGGACAAGTCGGAGATCGAGGAGGTGGCGCGCTTCCGTAATCTCACCCCCGAGCA
GCGACACATGATGGAGTCGGCCGTGAAGGAGCCGCCCAAGTACACCGAGGGCGTGCTCATCAGCGCGACC
GGCCAGTGGTTGTTCCGGAACGTGCCGCCCGCTGTTCCCATCGCTCTCGCGATGACGGAAGGGCACGAGA
AGGCACACCGTCGGCGCCTCATGGATGCCCACGGCTGTACCGAGCTCGATGCGGCCTACATGGTGGCCGA
GAAGCTGGCGGAGGCACGGGCATGA