SecReT4
Protein ID: 120611420
T4SS name [ID]Tfc [726]
Gene symbol-
Locus tagAave_2756
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]3030791..3031276 [-]
Producthypothetical protein
Component typeTfc15
UniProt IDA1TQT6
KEGG IDaav:Aave_2756
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 161 a.a.     [Download]
>gi|120611420|ref|YP_971098.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MASNSRILAVLSLSATLLAGCSVSGPRESPLKEVTEGSPTVLDVYRGKAAGGAPERSLATPRDRLEQDAP
ARPLAADDGRTQRYWSAVEPMQQRFARLANPDLVMVVYPHLAKGKYPVPGYVTVFPMYEQTEYALPGEVQ
EDLQRGRAAVQGRSPAEGGRR
 
Nucleotide Sequence: 486 bp     [Download]
>gi|120608714|ref|NC_008752.1|:c3031276-3030791 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGGCCTCGAATAGCCGCATCCTCGCTGTCCTATCGCTTTCCGCTACCCTGCTTGCCGGTTGCTCCGTCA
GCGGTCCGAGAGAGAGCCCGCTCAAGGAGGTGACCGAAGGCAGTCCCACCGTCCTGGACGTCTACCGCGG
CAAGGCCGCCGGCGGGGCGCCTGAGCGGTCCCTGGCCACGCCTCGGGACCGGCTGGAGCAGGACGCGCCC
GCGCGCCCGCTCGCTGCCGACGATGGCCGGACCCAGCGCTATTGGTCGGCCGTCGAGCCCATGCAGCAGC
GCTTCGCCCGCCTGGCGAACCCCGATCTGGTGATGGTCGTGTACCCGCACTTGGCGAAGGGCAAGTACCC
GGTGCCGGGATACGTCACGGTGTTCCCGATGTACGAGCAGACGGAGTACGCCCTCCCCGGCGAGGTGCAG
GAAGATCTGCAGCGCGGCCGCGCCGCCGTCCAGGGCCGCTCGCCCGCCGAAGGAGGCCGTCGATGA