SecReT4
Protein ID: 120611422
T4SS name [ID]Tfc [726]
Gene symbol-
Locus tagAave_2758
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]3032726..3033493 [-]
Producthypothetical protein
Component typeTfc13
UniProt IDA1TQT8
KEGG IDaav:Aave_2758
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 8.8e-48, Aligned region: 14..253
Protein Sequence: 255 a.a.     [Download]
>gi|120611422|ref|YP_971100.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MGPAPLTGTASAPAERAVFAREPVRVNLTVGQERLVTLPADALLHVPSDIEAVARVESIGGTLYVTALVP
FTPIRIVAELVDSGQQIPLDLVANKPSGAGAAGGELQVSVVEPGTVAQPTAVDGVATGPRAAAGPEVDMV
QLTRYAARQLYAPRRLASPIAGVSQVAVTGDELAGLVRGAAVQAVPVGQWRAGGLTVTAVRISNRSRFPL
EVPLESLRGRWLAATAQHGRIGPAGSDTDTTAIYLVCERAFESCL
 
Nucleotide Sequence: 768 bp     [Download]
>gi|120608714|ref|NC_008752.1|:c3033493-3032726 Acidovorax citrulli AAC00-1 chromosome, complete genome
GTGGGGCCTGCGCCGCTCACAGGTACCGCGTCTGCCCCGGCCGAACGGGCAGTTTTCGCGCGAGAGCCGG
TGCGGGTGAACCTGACCGTGGGCCAGGAGCGCCTTGTCACGCTGCCGGCTGACGCCCTGCTGCATGTCCC
GAGCGACATCGAGGCCGTTGCCCGCGTCGAGTCGATTGGTGGAACGCTGTACGTGACGGCCCTGGTGCCG
TTCACGCCCATTCGCATCGTCGCCGAGCTCGTGGACAGCGGCCAGCAAATCCCGCTGGATCTGGTGGCCA
ACAAGCCGTCCGGCGCCGGAGCGGCGGGCGGCGAATTGCAGGTGTCCGTCGTGGAGCCTGGCACGGTGGC
GCAGCCGACCGCCGTGGACGGTGTGGCTACCGGGCCCCGGGCCGCAGCGGGACCGGAGGTGGACATGGTG
CAGCTGACCCGGTACGCCGCTCGCCAGCTGTATGCGCCGCGCCGGCTCGCAAGCCCTATCGCGGGCGTGA
GCCAGGTCGCCGTGACCGGCGATGAGTTGGCCGGCCTGGTGCGCGGCGCAGCCGTCCAGGCAGTGCCCGT
CGGACAGTGGCGGGCCGGCGGGCTGACCGTCACCGCCGTACGCATCTCCAACCGGTCGCGCTTCCCGCTG
GAAGTCCCTCTGGAAAGCCTGCGGGGGCGATGGCTGGCGGCGACCGCTCAGCACGGTCGCATCGGGCCTG
CTGGAAGTGATACCGACACCACGGCCATCTACCTGGTGTGCGAACGCGCGTTCGAGTCCTGTCTGTGA