SecReT4
Protein ID: 120611423
T4SS name [ID]Tfc [726]
Gene symbol-
Locus tagAave_2759
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]3033830..3034570 [-]
Producthypothetical protein
Component typeTfc12
UniProt IDA1TQT9
KEGG IDaav:Aave_2759
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 2.5e-82, Aligned region: 8..210
Protein Sequence: 246 a.a.     [Download]
>gi|120611423|ref|YP_971101.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MSSGQFLDALASERRHNDRLTKTMAGVIALGIVSTWFAWRQPKSVDVHLAPDVRAGDTVRVSDGRSPVPS
PNVYGFAYYIWQQVNRWQTDGAQDYGQQIFNLQYYLTPRCQAQLQADMELRQGKGELRRRTRQISEIPGF
PYSENRVLADGPDAWTVLLDMQVTETFGGQAVKDVFIRYPLRVVRFDVDRERNPWHLALDCFGANRPARL
NPADLKAGTDVRISVQAPRLPGTISPSSLPRDTAVD
 
Nucleotide Sequence: 741 bp     [Download]
>gi|120608714|ref|NC_008752.1|:c3034570-3033830 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGAGCAGTGGTCAATTTCTCGACGCTCTTGCGTCCGAGCGGCGTCACAACGACCGACTCACGAAGACCA
TGGCGGGCGTGATCGCGCTCGGCATCGTCAGCACCTGGTTCGCCTGGCGCCAGCCGAAGTCGGTGGATGT
CCACCTGGCCCCCGACGTGCGGGCGGGTGACACGGTCCGCGTCAGCGATGGTCGATCGCCGGTGCCATCG
CCCAACGTCTACGGCTTTGCCTACTACATCTGGCAGCAAGTCAACCGCTGGCAGACCGATGGTGCCCAGG
ACTATGGGCAGCAGATCTTCAACTTGCAGTACTACCTCACGCCGCGCTGCCAGGCCCAGCTGCAGGCGGA
CATGGAGCTGCGGCAAGGCAAGGGCGAATTGCGCCGGCGCACCCGGCAGATCTCCGAGATCCCAGGCTTC
CCCTACTCCGAAAACCGCGTGCTTGCGGATGGCCCCGATGCCTGGACCGTGCTCCTGGACATGCAGGTCA
CCGAGACGTTCGGCGGGCAGGCGGTGAAGGACGTCTTCATTCGCTACCCGCTGCGCGTTGTGCGATTCGA
CGTAGACCGCGAACGCAATCCCTGGCATCTCGCGCTGGACTGCTTCGGCGCGAATCGCCCTGCCCGCCTA
AACCCGGCGGATCTCAAGGCCGGGACCGATGTGCGTATCAGCGTGCAGGCGCCTCGGCTGCCCGGAACGA
TCTCCCCATCCAGCCTGCCGCGGGACACGGCCGTTGATTGA