SecReT4
Protein ID: 120611428
T4SS name [ID]Tfc [726]
Gene symbol-
Locus tagAave_2764
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]3036787..3039045 [-]
Producthypothetical protein
Component typeTfc6
UniProt IDA1TQU4
KEGG IDaav:Aave_2764
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 4e-11, Aligned region: 514..643
TrwB_AAD_bind [PF10412], Evalue: 1e-10, Aligned region: 187..234
TrwB_AAD_bind [PF10412], Evalue: 1e-10, Aligned region: 516..653
AAA_10 [PF12846], Evalue: 1.8e-08, Aligned region: 195..591
Protein Sequence: 752 a.a.     [Download]
>gi|120611428|ref|YP_971106.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MSEAVMEGLLRPPVEGWSAATAYGIAGVAVAAPWALMMPQPLGLVTGAIAAAFGTVRAREALHVYRYQRG
LKFTKITRVAPHRLPVTREHLYLGEGFEWTQKHTQRKLDTQAKKVQEYVRPSGMERQLAEAGERIRKWVD
SKPKDPVRKAVRAAVDLGGTANPFATGVDLGGNPILHGVGVLEERPVKLRQTSRSGHMLVMGTTRVGKTR
LLELLSTQDIHAGHVVIVIDPKGDAELMLRMQAEARRAGREDSFYLFHLGYPEISARYNGIGNFARITEV
AGRATNALPSAGNSAAFKEFSWRFTNIVAQAQVALGRIPTYETLLKDVTGIDPLFMDYANMVFRKLAAEG
RFADYEDRLHDLQKAIQAKKAPVPRSLADRAPELVAMYLWIKESRLEDKVLLGLAAAFSYERSFYEKIVA
SLGPFLEKLTSGAVGKLISPDYFDPDDKRPIFDWMTVFRQGGIVYAGLDALSDSVVSSAVGNSMLSDLVS
TGGKLYKTGLNPHSQDGKLQLPTVCCHFDEVNEIAGPEFVPMVNKLGGSGFRITAYTQSMFDIEAKVGDK
AKAGQIMDNFNHLVMLRVRSVATANLMAEQLPQVNVVHLTPMSGVSDTAAKGDGVDFLSRNDDIVTSVKS
PLFEASDILELPQGQAFALLEGNRRFKIRIPLADTTDDPFIPQSLKVVAEDMKRRYRTSERWAAETDWLG
TQPLGAGAAGLIDTHLADDDGDDDAGTAAVHGTHGSALSHSAVMGNLMGHQQ
 
Nucleotide Sequence: 2259 bp     [Download]
>gi|120608714|ref|NC_008752.1|:c3039045-3036787 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGAGCGAGGCGGTCATGGAAGGCCTGCTGCGGCCTCCGGTCGAGGGTTGGAGCGCCGCCACGGCCTACG
GCATCGCGGGCGTAGCAGTGGCCGCGCCTTGGGCACTGATGATGCCGCAGCCGCTCGGCCTGGTGACCGG
TGCCATCGCCGCCGCGTTCGGCACCGTGCGGGCCCGCGAGGCGCTGCACGTGTATCGATACCAGCGCGGC
CTGAAATTCACCAAGATCACGCGCGTCGCCCCGCACAGGCTCCCCGTGACACGCGAGCACCTGTACCTGG
GCGAAGGCTTCGAGTGGACGCAGAAGCACACCCAGCGCAAGCTCGACACCCAGGCCAAGAAGGTGCAGGA
GTACGTCAGGCCGAGCGGCATGGAGCGGCAACTGGCGGAGGCGGGCGAGCGCATCCGAAAGTGGGTGGAC
TCCAAGCCGAAGGATCCTGTCCGAAAGGCGGTGCGCGCCGCGGTAGACCTGGGCGGCACCGCTAACCCCT
TCGCCACGGGTGTGGACCTGGGTGGGAACCCTATCCTGCACGGCGTTGGCGTGCTCGAAGAGCGTCCGGT
CAAGCTGCGGCAGACCTCCCGGTCAGGCCACATGCTCGTGATGGGCACCACGCGGGTCGGCAAGACCAGG
CTGCTCGAACTGCTCTCCACCCAGGACATTCACGCGGGTCATGTGGTCATCGTGATTGATCCGAAGGGCG
ATGCCGAGCTCATGCTCCGCATGCAAGCAGAGGCGCGCCGCGCCGGACGCGAAGACAGCTTCTACCTGTT
CCACCTCGGGTATCCGGAGATCAGTGCCCGGTACAACGGGATCGGCAATTTCGCGCGAATCACCGAGGTG
GCGGGCAGGGCAACAAACGCCCTGCCCTCGGCCGGCAACTCTGCGGCGTTCAAGGAGTTCTCCTGGCGGT
TCACCAACATCGTCGCGCAGGCGCAGGTGGCGCTGGGCCGCATCCCGACTTACGAGACGCTGCTCAAGGA
TGTGACCGGGATCGACCCGCTGTTCATGGACTACGCGAACATGGTGTTTCGCAAGCTGGCGGCCGAGGGG
CGGTTCGCCGACTACGAAGACCGGCTGCATGATCTGCAGAAGGCCATCCAGGCGAAGAAGGCGCCGGTAC
CGCGCAGCCTCGCGGACCGCGCCCCCGAGCTCGTGGCCATGTACCTGTGGATCAAGGAATCCCGGCTCGA
GGACAAGGTGCTGCTCGGCCTGGCCGCGGCGTTCTCCTACGAGCGGTCCTTCTACGAAAAAATCGTCGCG
TCCCTGGGCCCGTTCCTGGAGAAGCTCACCTCGGGCGCAGTGGGCAAGCTCATCTCGCCGGACTACTTCG
ACCCGGACGACAAGCGTCCCATCTTCGACTGGATGACCGTGTTCCGCCAAGGCGGCATCGTCTACGCCGG
CCTGGATGCGCTCTCGGACTCCGTGGTGTCGTCGGCCGTCGGCAACTCGATGCTGTCCGACCTGGTCTCC
ACGGGCGGCAAGCTCTACAAGACCGGCCTGAACCCGCACAGCCAGGACGGCAAGCTCCAACTGCCGACGG
TGTGCTGCCACTTCGATGAGGTGAACGAGATCGCCGGCCCCGAGTTCGTGCCCATGGTGAACAAGCTGGG
CGGCTCGGGCTTCAGGATCACGGCCTACACCCAGTCCATGTTCGACATCGAGGCCAAGGTGGGCGACAAG
GCCAAGGCCGGCCAGATCATGGACAACTTCAACCACTTGGTCATGCTCCGCGTGCGGTCCGTCGCCACGG
CCAACCTCATGGCCGAGCAGCTGCCGCAGGTGAACGTGGTCCACCTCACGCCGATGAGCGGCGTGAGCGA
CACGGCGGCCAAGGGCGACGGAGTGGACTTCCTGTCCCGCAACGACGACATCGTGACCTCGGTGAAGTCG
CCGCTCTTCGAGGCCTCGGACATCCTGGAGCTGCCGCAGGGGCAGGCATTCGCGCTGCTCGAAGGCAACA
GGCGTTTCAAGATCCGCATTCCGCTGGCGGACACCACCGACGACCCCTTCATCCCCCAGTCCCTCAAGGT
GGTCGCAGAGGACATGAAGCGCCGGTACCGCACCAGCGAGCGGTGGGCCGCGGAAACCGACTGGCTGGGC
ACGCAGCCGCTGGGCGCCGGCGCCGCCGGGCTCATCGACACGCATCTGGCCGACGACGACGGTGATGACG
ACGCGGGCACTGCGGCAGTCCACGGCACGCACGGATCGGCGTTGTCGCACAGCGCGGTGATGGGCAACCT
CATGGGTCACCAGCAATGA