SecReT4
Protein ID: 120611429
T4SS name [ID]Tfc [726]
Gene symbol-
Locus tagAave_2765
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]3039042..3039695 [-]
Producthypothetical protein
Component typeTfc5
UniProt IDA1TQU5
KEGG IDaav:Aave_2765
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 3.8e-32, Aligned region: 40..179
Protein Sequence: 217 a.a.     [Download]
>gi|120611429|ref|YP_971107.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MTMQRRSILRAAALLAGHLPGLAAAAAQGRDGADVALQIIHDSGRGVPMAPYLAQLAGDADDPGALSGVP
FPFVSRRLRGGVLQVEGTAVFQPEWLTEAVFVVAADDVSFRWLAYNHARLVQMQAVGVVVQAGTAAAYQV
MQRLARPMRLAPDSGEWVSERLAAAGADVYPVLVQTDGRAYQILTQDTGPAASGRSSLEQPMPAHVQKLP
RQVGGRR
 
Nucleotide Sequence: 654 bp     [Download]
>gi|120608714|ref|NC_008752.1|:c3039695-3039042 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGACGATGCAACGACGAAGCATTCTTCGCGCTGCTGCGTTGTTGGCCGGGCACCTGCCCGGCCTGGCCG
CTGCTGCAGCGCAGGGCCGCGATGGCGCAGACGTCGCCCTGCAGATCATCCACGACAGCGGCCGCGGCGT
TCCGATGGCCCCTTACCTCGCCCAGCTGGCCGGCGATGCCGATGACCCGGGCGCCCTCTCCGGCGTCCCC
TTCCCATTCGTGAGCCGCCGCCTGCGCGGCGGCGTGCTGCAGGTGGAGGGCACGGCGGTGTTCCAGCCCG
AATGGCTGACCGAGGCCGTGTTCGTAGTCGCCGCCGACGACGTGTCGTTCCGGTGGCTTGCGTACAACCA
TGCCCGCCTGGTGCAGATGCAGGCAGTTGGGGTGGTGGTCCAGGCCGGGACCGCTGCCGCCTACCAGGTG
ATGCAGCGGTTGGCCCGCCCAATGCGCCTGGCTCCGGATTCTGGCGAGTGGGTGTCCGAGCGGCTGGCCG
CCGCCGGCGCCGACGTCTACCCGGTCCTGGTGCAGACGGATGGTCGTGCGTACCAGATCCTGACGCAGGA
TACCGGCCCCGCTGCTTCGGGACGGTCATCGCTGGAGCAGCCTATGCCTGCCCACGTCCAGAAGCTGCCC
CGGCAGGTGGGAGGGCGTCGATGA