SecReT4
Protein ID: 120611430
T4SS name [ID]Tfc [726]
Gene symbol-
Locus tagAave_2766
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]3039692..3040222 [-]
Producthypothetical protein
Component typeTfc3
UniProt IDA1TQU6
KEGG IDaav:Aave_2766
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 176 a.a.     [Download]
>gi|120611430|ref|YP_971108.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MRSIAMTIAAATLIGASPALAQVRTGRTAEASSTASTSSTSRTQADSTDLQVQQIWGLTAEEMRRAKVLA
LGPRGSFSVDKLSPLEILGIHARTDAERRQYAERLARIFHEDVARSIAWEREMAAAMARLYPNEPMVSYE
GLPRVQSSVGAADVANVPRSQILEQPSLSPRVPARR
 
Nucleotide Sequence: 531 bp     [Download]
>gi|120608714|ref|NC_008752.1|:c3040222-3039692 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGCGCAGCATTGCGATGACGATCGCCGCCGCCACGCTCATCGGCGCTTCACCCGCGTTGGCGCAGGTGC
GCACGGGCCGGACCGCAGAAGCGAGCTCGACTGCCTCGACATCGTCCACGTCGCGCACGCAGGCCGACTC
CACGGACCTGCAGGTGCAGCAGATCTGGGGCCTGACGGCAGAAGAGATGCGCCGCGCCAAGGTGCTGGCA
CTCGGGCCACGCGGAAGCTTTTCCGTGGACAAGCTCAGTCCGCTGGAGATCCTCGGGATCCATGCCCGCA
CTGATGCGGAGCGGCGTCAATACGCTGAGCGCCTGGCGCGGATCTTCCACGAGGACGTTGCGCGGTCCAT
TGCCTGGGAGCGCGAAATGGCCGCTGCCATGGCGCGGCTGTACCCCAACGAGCCCATGGTCAGCTACGAA
GGTCTGCCGCGGGTGCAGAGTTCCGTGGGCGCCGCGGACGTCGCCAATGTGCCGCGTAGCCAGATCCTGG
AGCAGCCGTCGCTTTCGCCGCGGGTGCCCGCCCGCCGATGA