SecReT4
Protein ID: 120611432
T4SS name [ID]Tfc [726]
Gene symbol-
Locus tagAave_2768
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]3041429..3041923 [-]
Producthypothetical protein
Component typeTfc2
UniProt IDA1TQU8
KEGG IDaav:Aave_2768
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 164 a.a.     [Download]
>gi|120611432|ref|YP_971110.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MTRHLTRCLASGVMLLLQSAVTHSSPALVDGNTRVMLGRYSTAEAVPQQSLSEPLELVAQITFPREQVTT
IGDAIEYTLLRTGYALPDRKGLPADAQQFLTLPLPEAQRTLGPFSVQDILNVLVGKAWRWQTDPVTRRVW
FTLVNGPTPRQLQPIVSPAPVAKP
 
Nucleotide Sequence: 495 bp     [Download]
>gi|120608714|ref|NC_008752.1|:c3041923-3041429 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGACACGGCACCTGACCCGTTGCCTCGCGTCCGGCGTGATGCTGCTGCTGCAGTCCGCGGTGACGCACT
CGTCTCCCGCTCTCGTGGACGGCAACACGCGCGTGATGCTGGGCCGCTACTCCACCGCCGAGGCAGTACC
TCAGCAGAGCTTGAGTGAGCCGCTGGAGCTCGTGGCGCAGATCACCTTTCCTCGCGAGCAGGTGACGACG
ATCGGTGACGCGATCGAGTACACGTTGCTGCGGACCGGCTATGCACTGCCGGACAGGAAGGGTCTTCCAG
CCGATGCACAGCAATTTCTCACTCTGCCGTTGCCGGAGGCTCAACGTACGCTCGGACCCTTTAGCGTGCA
GGACATCTTGAACGTCCTGGTCGGCAAAGCCTGGCGGTGGCAGACCGACCCGGTGACTCGCCGCGTCTGG
TTCACGTTGGTGAACGGACCGACGCCGCGACAGCTCCAGCCGATCGTGTCGCCCGCGCCCGTCGCAAAGC
CGTAG