SecReT4
Protein ID: 134287891
T4SS name [ID]Tra_I [180]
Gene symbol-
Locus tagBcep1808_7654
StrainBurkholderia vietnamiensis G4
Repliconplasmid pBVIE04 [GenBank: NC_009228] [Browse all T4SS(s) in this replicon]
Location [Strand]96468..97595 [-]
ProductTrbA-like protein
Component typeTrbA_I
UniProt IDA4JW71
KEGG IDbvi:Bcep1808_7654
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 375 a.a.     [Download]
>gi|134287891|ref|YP_001110056.1| TrbA-like protein [Burkholderia vietnamiensis G4]
MSATQGKRDDMGLVYLGMLGLAAGFCWFMWYSSHADIVYYGLKFAWYQLSALDWPFMPNAIRRWKQETAY
LAMNPAAVSFEQFLAMMNKAGYLFVWIPVLLAIRGIKLAVKHKANLTRRKVTVQTLPWIMSNHSPAIIPS
LYYGDKDTLLLNVDPEEHRSSINPEEWVEQHGLLVNGVLDRERCRELLIADLGKPVKSLDELLPQEKAMF
AIFGTRLLSDGKDGAKAQELLDALNRSCHNHTWNGMKGYPDLSIASKAFAKYSQHPEAQRWLEKHPYPRT
LLHAMHKAAQGSGKLPSSHFRWLKGMDRGLWYALNTTGRKVPFLESAAVFTQTLWEDLAFDSGYRLTEPY
VDDAIDGVEAYLIKVGLMAPRKNQE
 
Nucleotide Sequence: 1128 bp     [Download]
>gi|134287794|ref|NC_009228.1|:c97595-96468 Burkholderia vietnamiensis G4 plasmid pBVIE04, complete sequence
ATGAGTGCAACGCAAGGTAAGCGCGATGACATGGGCCTCGTGTATCTCGGGATGCTCGGGCTCGCGGCCG
GCTTTTGCTGGTTCATGTGGTACTCGTCGCACGCGGACATCGTGTATTACGGCCTCAAGTTCGCGTGGTA
TCAGCTGTCGGCACTGGACTGGCCGTTCATGCCGAACGCGATTCGGCGCTGGAAACAGGAAACCGCCTAT
CTGGCGATGAATCCGGCGGCCGTTTCGTTCGAACAGTTTTTGGCGATGATGAACAAAGCCGGGTATCTGT
TCGTATGGATTCCGGTCCTGTTGGCGATCCGCGGAATCAAGCTCGCGGTGAAGCACAAGGCAAACCTCAC
CCGGCGCAAGGTCACGGTGCAAACGCTTCCGTGGATCATGTCGAATCACTCGCCAGCGATCATCCCGTCG
CTCTACTACGGAGACAAAGACACGCTGCTGCTCAACGTCGACCCCGAGGAACACCGCAGTTCGATCAATC
CCGAAGAGTGGGTCGAGCAGCATGGTCTGCTCGTGAACGGCGTGCTCGACCGGGAGCGTTGTCGCGAGCT
GCTGATCGCCGATCTCGGCAAGCCCGTGAAGTCGTTGGACGAGTTACTGCCGCAGGAGAAGGCGATGTTT
GCGATCTTCGGCACACGCTTGCTATCCGACGGCAAGGACGGCGCCAAGGCGCAGGAACTTCTCGATGCGT
TGAACCGTTCGTGCCACAATCACACGTGGAACGGAATGAAGGGCTACCCGGATCTGTCGATCGCGAGCAA
GGCATTCGCCAAATATTCGCAGCATCCCGAAGCGCAGCGCTGGCTCGAAAAACACCCCTACCCGCGCACG
TTGCTGCACGCAATGCACAAGGCAGCGCAGGGGTCCGGCAAGCTCCCGTCATCGCATTTCCGATGGCTCA
AGGGAATGGACCGTGGGCTTTGGTACGCCCTGAACACCACGGGCCGCAAGGTTCCTTTTCTCGAATCCGC
CGCAGTCTTCACGCAGACCCTATGGGAAGACTTGGCGTTTGACAGCGGCTACCGGCTCACCGAGCCCTAC
GTCGACGACGCGATCGACGGCGTGGAAGCCTACCTCATCAAAGTCGGCCTTATGGCCCCGCGCAAGAACC
AGGAGTAA