SecReT4
Protein ID: 148244025
T4SS name [ID]VirB [24]
Gene symbol-
Locus tagAcry_3521
StrainAcidiphilium cryptum JF-5
Repliconplasmid pACRY03 [GenBank: NC_009469] [Browse all T4SS(s) in this replicon]
Location [Strand]52647..53012 [+]
ProductVIRB2 type IV secretion fmaily protein
Component typeVirB2
UniProt IDA5FU39
KEGG IDacr:Acry_3521
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.8e-20, Aligned region: 28..117
Protein Sequence: 121 a.a.     [Download]
>gi|148244025|ref|YP_001220263.1| VIRB2 type IV secretion fmaily protein [Acidiphilium cryptum JF-5]
MKQRLTKLRDRVANFAAGTVSKIDRGAWIQPAVLVTVGFLLPAVAHAQVVSGGTSPTTIIDNIATFILGP
FGEGVAVLAVAAVGFMCWTGRMGFHAIGWLAAGLVLVFGSSYLVTTFVGGG
 
Nucleotide Sequence: 366 bp     [Download]
>ref|NC_009469.1|:52647-53012 VIRB2 type IV secretion fmaily protein [Acidiphilium cryptum JF-5]
GTGAAACAAAGGCTCACTAAGCTGCGCGATCGCGTGGCAAATTTCGCGGCTGGGACGGTTTCAAAAATAG
ATCGAGGGGCATGGATCCAGCCAGCCGTCCTTGTGACGGTCGGCTTCCTCCTGCCCGCCGTGGCCCATGC
GCAGGTCGTTTCTGGCGGCACCAGCCCGACAACCATCATCGACAACATCGCGACATTCATCCTCGGCCCA
TTCGGCGAGGGGGTTGCCGTGCTCGCCGTGGCCGCAGTCGGCTTCATGTGCTGGACCGGCCGCATGGGCT
TCCATGCGATCGGCTGGCTCGCGGCCGGCCTGGTGCTGGTGTTTGGCAGCTCCTACCTCGTGACAACCTT
CGTGGGCGGCGGCTGA