SecReT4
Protein ID: 15611556
T4SS name [ID]Cag [38]
Gene symbolcagH
Locus tagjhp0489
StrainHelicobacter pylori J99
Repliconchromosome [GenBank: NC_000921] [Browse all T4SS(s) in this replicon]
Location [Strand]536477..537589 [-]
Productcag island protein
Component typeCagH
UniProt IDQ9ZLT7
KEGG IDhpj:jhp0489
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 370 a.a.     [Download]
>gi|15611556|ref|NP_223207.1| cag island protein [Helicobacter pylori J99]
MAGTQAIYESSSAGFLSQVSSIISSTSGVAGPFAGIVAGAMTAAIIPIVVGFTNPQMTAIMTQYNQSIAE
AVSVPMKAANQQYNQLYQGFNDQSMAVGNNILNISKLTGEFNAQGNTQSAQISAVNSQIASILASNTTPK
NPSAIEAYATNQIAVPSVPTTVEMMSGILGNITSAAPKYALALQEQLRSQASNSSMNDTADSLDSCTALG
ALVGSSKVFFSCMQISMTPMSVSMPTVYAKYQAVATKALTSGVNPMTTPACPIGDKVLAVYCYAEKVAEI
LREYYIEFVKNNTNLLQNASQMILNQSGLATSTYDTQAISNISSLYNYNIVANKSFLKSHLTYLDYIKDK
LKGQKDSYLTERVQTKIIVK
 
Nucleotide Sequence: 1113 bp     [Download]
>gi|15611071|ref|NC_000921.1|:c537589-536477 Helicobacter pylori J99 chromosome, complete genome
ATGGCAGGCACACAAGCTATATATGAATCATCTTCTGCAGGATTCTTATCGCAAGTCTCCTCAATCATCT
CAAGCACAAGTGGTGTCGCAGGGCCATTTGCAGGAATAGTAGCGGGCGCTATGACAGCAGCGATTATTCC
TATTGTTGTGGGATTTACTAATCCGCAAATGACCGCTATCATGACCCAATACAATCAAAGCATCGCTGAA
GCTGTAAGCGTGCCTATGAAAGCCGCTAACCAACAATACAACCAATTGTATCAAGGTTTTAACGATCAAA
GCATGGCTGTGGGGAACAATATCTTAAATATCAGCAAATTAACAGGGGAATTTAACGCGCAAGGCAACAC
GCAAAGCGCGCAAATTAGTGCTGTCAATAGTCAGATTGCAAGCATTTTAGCGAGTAACACTACCCCTAAA
AATCCTAGCGCTATTGAAGCTTATGCGACGAATCAAATCGCTGTTCCTAGCGTGCCAACAACGGTTGAAA
TGATGAGCGGTATATTAGGCAATATTACAAGCGCAGCACCAAAATACGCCCTAGCTCTACAAGAGCAACT
GCGTTCTCAAGCAAGCAACAGCTCAATGAATGATACAGCCGATTCCCTTGATAGCTGTACCGCTTTAGGC
GCACTTGTTGGCTCATCAAAAGTGTTTTTCAGTTGCATGCAAATTTCTATGACTCCTATGAGTGTTTCTA
TGCCCACTGTTTATGCCAAATACCAAGCGGTTGCCACTAAAGCCCTAACTTCAGGCGTTAATCCTATGAC
CACTCCTGCATGCCCTATTGGGGACAAGGTTCTTGCCGTTTATTGCTATGCTGAAAAAGTAGCAGAAATT
TTGAGAGAATACTATATAGAATTTGTGAAAAACAATACCAATTTGTTGCAGAACGCTTCTCAAATGATAC
TTAATCAATCAGGATTAGCTACTAGCACCTATGACACTCAAGCGATTTCTAACATAAGCTCGCTATATAA
TTACAATATAGTAGCGAATAAATCTTTTTTGAAATCGCATTTGACTTATCTTGATTACATCAAAGACAAG
CTTAAGGGGCAAAAAGATAGCTACTTAACAGAAAGGGTGCAGACTAAAATAATCGTGAAGTGA