SecReT4
Protein ID: 157418111
T4SS name [ID]Tra_F [111]
Gene symboltraY
Locus tagAPECO1_O1CoBM28
StrainEscherichia coli APEC O1
Repliconplasmid pAPEC-O1-ColBM [GenBank: NC_009837] [Browse all T4SS(s) in this replicon]
Location [Strand]19808..20209 [+]
Productconjugal transfer protein TraY
Component typeTraY_F
UniProt IDQ27TJ4
KEGG IDecv:APECO1_O1CoBM28
PDB IDNA
Domain hit(s) vs Pfam TraY [PF05509], Evalue: 2.3e-37, Aligned region: 18..60
TraY [PF05509], Evalue: 2.3e-37, Aligned region: 72..119
Protein Sequence: 133 a.a.     [Download]
>gi|157418111|ref|YP_001481183.1| conjugal transfer protein TraY [Escherichia coli APEC O1]
MLLKRFGTRSATGKMVKLKLPVDVGSLLIEASNRSGRSRSFEAVIRLKDHLHRYPKFNRAGNIYGKSLVK
YLTMRLDDETNQLLIAAKNRSGWCKTDEAADRVIDHLIKFPDFYNSEIFREADKEEDITFNTL
 
Nucleotide Sequence: 402 bp     [Download]
>gi|157418083|ref|NC_009837.1|:19808-20209 Escherichia coli APEC O1 plasmid pAPEC-O1-ColBM, complete sequence
GTGTTATTGAAAAGATTTGGTACACGTTCTGCAACAGGTAAGATGGTAAAACTAAAATTACCTGTAGATG
TGGGAAGTCTATTAATTGAGGCAAGTAACAGAAGCGGAAGAAGTCGATCGTTTGAGGCAGTAATAAGACT
TAAAGATCATCTTCACCGCTATCCAAAGTTTAACAGGGCAGGGAATATCTATGGTAAGTCGCTGGTTAAG
TATCTGACAATGCGTCTGGATGATGAAACTAACCAGCTACTTATTGCAGCCAAAAATCGTAGTGGATGGT
GTAAAACAGATGAGGCTGCAGACAGAGTTATTGATCATTTGATCAAGTTTCCTGATTTTTATAACTCGGA
GATATTCAGGGAGGCAGATAAAGAGGAAGATATAACATTTAATACACTCTAG