SecReT4
Protein ID: 157418112
T4SS name [ID]Tra_F [111]
Gene symboltraA
Locus tagAPECO1_O1CoBM29
StrainEscherichia coli APEC O1
Repliconplasmid pAPEC-O1-ColBM [GenBank: NC_009837] [Browse all T4SS(s) in this replicon]
Location [Strand]20242..20607 [+]
Productconjugal transfer pilin subunit TraA
Component typeTraA_F
UniProt IDQ27TJ3
KEGG IDecv:APECO1_O1CoBM29
PDB IDNA
Domain hit(s) vs Pfam TraA [PF05513], Evalue: 1.9e-59, Aligned region: 1..120
Protein Sequence: 121 a.a.     [Download]
>gi|157418112|ref|YP_001481184.1| conjugal transfer pilin subunit TraA [Escherichia coli APEC O1]
MNAVLSVQGASAPVKKKSFFSKFTRLNMLRLARAVIPAAVLMMFFPQLAMAAGSSGQDLMASGNTTVKAT
FGKDSSVVKWVVLAEVLVGAVMYMMTKNVKFLAGFAIISVFIAVGMAVVGL
 
Nucleotide Sequence: 366 bp     [Download]
>gi|157418083|ref|NC_009837.1|:20242-20607 Escherichia coli APEC O1 plasmid pAPEC-O1-ColBM, complete sequence
ATGAATGCTGTTTTAAGTGTTCAGGGTGCTTCTGCGCCCGTCAAAAAGAAGTCGTTTTTTTCCAAATTCA
CTCGTCTGAATATGCTTCGCCTGGCTCGCGCAGTGATCCCGGCTGCTGTTCTGATGATGTTCTTCCCGCA
GCTGGCGATGGCCGCCGGCAGCAGTGGTCAGGACCTGATGGCAAGCGGTAACACCACGGTTAAGGCGACC
TTCGGTAAGGACTCCAGTGTTGTTAAATGGGTTGTTCTGGCTGAAGTTCTGGTCGGTGCTGTCATGTACA
TGATGACCAAAAACGTCAAGTTCCTGGCCGGTTTTGCCATCATCTCTGTATTTATTGCTGTGGGTATGGC
CGTCGTTGGCCTCTGA