SecReT4
Protein ID: 157418127
T4SS name [ID]Tra_F [111]
Gene symboltraN
Locus tagAPECO1_O1CoBM44
StrainEscherichia coli APEC O1
Repliconplasmid pAPEC-O1-ColBM [GenBank: NC_009837] [Browse all T4SS(s) in this replicon]
Location [Strand]30990..32798 [+]
Productconjugal transfer mating pair stabilization protein TraN
Component typeTraN_F
UniProt IDQ27TH8
KEGG IDecv:APECO1_O1CoBM44
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 3.2e-74, Aligned region: 306..552
Protein Sequence: 602 a.a.     [Download]
>gi|157418127|ref|YP_001481199.1| conjugal transfer mating pair stabilization protein TraN [Escherichia coli APEC O1]
MKRILPLILALVAGMAQADSNSDYRAGSDFAHQIKGQGSSSIQGFKPQESIPGYNANPDETKYYGGVTAG
GDGGLKNDGTTEWATGETGKTITESFMNKPKDILSPDAPFIQTGRDVVNRADSIVGNTGQQCSAQEISRS
EYTNYTCERDLQVEQYCTRTARMELQGSTTWETRTLEYEMSQLPAREVNGQYVVSMTSPVTGEIVDAHYS
WSRTYLQKSVPMTITVLGTPLSWNAKYSADASFTPVQKTLTAGVAFTSSHPVRVGNTKFKRHTAMKLRLV
VRVKKASYTPYVVWSESCPFSKELGKLTKTECTEAGGNRTLVKDGQSYSMYQSCWAYRDTYVTQSADKGT
CQTYTDNPACTLVSHQCAFYSEEGACLHEYATYSCESKTSGKVMVCGGDVFCLDGECDKAQSGQSNDFAE
AVSQLAALAAAGKDVAALNGVDVRAFTGQAKFCKKAAAGYSNCCKDSGWGQDIGLAKCSSDEKALAKAKS
NKLTVSVGEFCSKKVLGVCLEKKRSYCQFDSKLAQIVQQQGRNGQLRISFGSAKHPDCRGITVDELQKIQ
FNRLDFTNFYEDLMNNQKIPDSGVLTQKVKEQIADQLKQAGQ
 
Nucleotide Sequence: 1809 bp     [Download]
>gi|157418083|ref|NC_009837.1|:30990-32798 Escherichia coli APEC O1 plasmid pAPEC-O1-ColBM, complete sequence
ATGAAACGTATTTTACCTCTGATACTGGCTCTGGTTGCCGGCATGGCACAGGCTGACAGCAACAGTGATT
ACCGGGCCGGTTCTGATTTTGCTCACCAGATCAAAGGGCAGGGAAGCAGCAGTATTCAGGGCTTTAAGCC
ACAGGAGAGTATCCCCGGCTATAACGCGAATCCGGACGAGACAAAATATTACGGTGGCGTGACTGCCGGC
GGGGATGGCGGCCTGAAAAATGACGGCACCACGGAATGGGCGACCGGTGAAACCGGAAAAACCATTACAG
AGTCATTCATGAACAAGCCGAAAGACATTCTTTCACCGGATGCACCGTTTATCCAGACCGGCAGGGATGT
GGTGAACCGGGCTGACAGCATTGTGGGAAACACCGGGCAGCAGTGCAGTGCGCAGGAGATTAGCAGGAGT
GAATACACGAATTACACCTGTGAGCGGGATTTACAGGTGGAGCAGTACTGCACACGAACTGCCCGTATGG
AGCTGCAGGGGAGTACCACATGGGAAACCCGGACGCTGGAGTATGAAATGAGTCAGCTACCTGCACGTGA
AGTGAATGGTCAGTATGTTGTCTCCATGACCTCTCCCGTTACCGGTGAAATTGTCGATGCGCATTACAGC
TGGAGTCGTACTTACTTGCAGAAGAGTGTACCTATGACAATTACAGTACTGGGAACCCCACTGAGCTGGA
ATGCCAAATACTCAGCAGATGCCTCATTTACACCAGTACAGAAAACACTGACTGCCGGTGTGGCTTTTAC
GTCATCTCACCCCGTCCGGGTCGGGAATACAAAATTCAAACGTCATACGGCAATGAAGCTGCGTCTGGTT
GTCAGGGTAAAAAAAGCCTCGTACACCCCGTATGTTGTCTGGTCTGAAAGCTGCCCGTTCAGCAAGGAGC
TGGGGAAACTGACAAAAACAGAATGTACGGAGGCTGGCGGGAACAGGACGCTGGTGAAAGACGGTCAGTC
ATACAGCATGTACCAGAGCTGCTGGGCATACCGGGACACGTATGTCACGCAGTCAGCAGACAAGGGAACC
TGTCAGACCTACACCGACAATCCTGCCTGTACCCTGGTGTCACACCAGTGTGCCTTTTACTCCGAAGAAG
GTGCCTGTCTGCATGAATATGCCACGTACTCCTGTGAGTCAAAAACATCCGGGAAAGTGATGGTCTGTGG
GGGAGACGTCTTCTGTCTCGATGGCGAATGCGATAAGGCTCAGAGCGGGCAGAGTAATGATTTTGCCGAA
GCCGTTTCTCAGCTGGCGGCACTGGCCGCAGCAGGTAAGGATGTTGCGGCGCTGAACGGGGTGGATGTCC
GTGCTTTCACCGGTCAGGCGAAATTTTGTAAGAAGGCTGCAGCCGGATACAGCAACTGCTGTAAGGACAG
CGGCTGGGGACAGGATATCGGGCTGGCCAAATGCAGCAGTGATGAAAAGGCCCTGGCTAAAGCAAAATCA
AACAAACTGACCGTCAGCGTCGGGGAGTTCTGTTCGAAGAAAGTGCTGGGTGTCTGTCTGGAGAAAAAAC
GCAGCTACTGTCAGTTTGATTCGAAGCTGGCGCAGATAGTCCAGCAGCAGGGGCGCAACGGTCAGTTGCG
TATCAGTTTTGGTAGTGCGAAGCATCCTGACTGTCGGGGGATTACGGTTGATGAGCTGCAGAAAATTCAG
TTCAACAGACTGGATTTCACTAACTTCTACGAAGACCTGATGAATAACCAGAAAATCCCGGACAGTGGCG
TTCTGACGCAGAAAGTGAAAGAGCAGATTGCTGACCAGCTGAAACAGGCAGGACAGTAA