SecReT4
Protein ID: 17233443
T4SS name [ID]Tra_F [105]
Gene symboltraA
Locus tagPSLT077
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. LT2
Repliconplasmid pSLT [GenBank: NC_003277] [Browse all T4SS(s) in this replicon]
Location [Strand]62636..62998 [+]
Productconjugal transfer pilin subunit TraA
Component typeTraA_F
UniProt IDH9L4B7
KEGG IDstm:PSLT077
PDB IDNA
Domain hit(s) vs Pfam TraA [PF05513], Evalue: 4.8e-53, Aligned region: 1..119
Protein Sequence: 120 a.a.     [Download]
>gi|17233443|ref|NP_490563.1| conjugal transfer pilin subunit TraA [Salmonella typhimurium LT2]
MSAILSVQGASAPVKKKSFLSTFTRLNLLKLARAVIPAAVLIFFFPQLAMAAGGSQDLMASGNGTVKATF
GKDSSAVKWVILAEVLVGAVMYMMTKNVKFLAGFAIISVFIAVGMAVVGL
 
Nucleotide Sequence: 363 bp     [Download]
>gi|17233403|ref|NC_003277.1|:62636-62998 Salmonella typhimurium LT2 plasmid pSLT, complete sequence
ATGAGCGCTATTTTAAGTGTTCAGGGTGCTTCTGCGCCCGTTAAAAAGAAATCGTTTCTGTCTACGTTCA
CACGTCTGAACCTGCTGAAACTTGCCCGCGCAGTGATCCCGGCGGCAGTACTGATATTCTTTTTCCCGCA
ACTGGCAATGGCTGCCGGCGGTTCGCAGGACCTGATGGCCAGCGGTAACGGTACGGTCAAGGCGACATTT
GGTAAGGATTCCAGCGCCGTCAAGTGGGTTATTCTCGCGGAAGTGCTGGTCGGTGCCGTGATGTACATGA
TGACCAAGAACGTCAAATTCCTGGCGGGTTTTGCCATCATCTCGGTCTTTATTGCCGTTGGTATGGCTGT
CGTCGGCCTCTGA