SecReT4
Protein ID: 17233459
T4SS name [ID]Tra_F [105]
Gene symboltraN
Locus tagPSLT095
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. LT2
Repliconplasmid pSLT [GenBank: NC_003277] [Browse all T4SS(s) in this replicon]
Location [Strand]74623..76449 [+]
Productconjugal transfer mating pair stabilization protein TraN
Component typeTraN_F
UniProt IDQ93GM7
KEGG IDstm:PSLT095
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 3.9e-75, Aligned region: 314..558
Protein Sequence: 608 a.a.     [Download]
>gi|17233459|ref|NP_490579.1| conjugal transfer mating pair stabilization protein TraN [Salmonella typhimurium LT2]
MKRMLPLFLLLAAGQAQADSNSDYRAGSDFAHQIKGQGTGSIRNFNPQESIPGYNANPDETKYYGGVTAG
GDSGLKNDGTTQWATGETGKTITESFMNKPKDILSPDAPFIEKGRDVVNRADSIVGNTGQQCSAQEINRS
EFTNYTCERDTTVEEYCTRTATITGDWRETTEVRTYTLTAFSFSRSGKQIVFSVTVPEAGTISSASLNVI
TQNYLWNSRAGFMNTIFNMTWGSTITLGGATGMMLSKGQILSGTSCSGNGSCTGTLDDRIFNELTSGRTT
FTLTLVMQVKDREWIPRVEWVESCPFNKADGVLKGTECSEPGGTKTGVMEGKPWSLTEACWAYRDKYVTQ
SADNGTCQAYVDNPACTLATRQCAFYSGEGTCLHEYATYSCESKTSGKVMICGGDVFCLDGECDKAQSGK
SNDFGEAVSQLAALAAAGKDVAALNGIDVRAFTGQAKFCKKAAAGYSNCCKDSGWGQDIGLAKCSSDEKA
LAKAKTNKLTVSVGEFCSKKVLGVCLEKKRSYCQFDSKLAQIVQQQGRNGQLHISFGSSKHPDCRGITVD
ELQQIKFDQLDLTNFYEDLMNNQKIPDSGALTEKVKEQIADQLRQAGK
 
Nucleotide Sequence: 1827 bp     [Download]
>gi|17233403|ref|NC_003277.1|:74623-76449 Salmonella typhimurium LT2 plasmid pSLT, complete sequence
ATGAAACGTATGTTACCTCTGTTTCTGCTTCTGGCAGCCGGCCAGGCACAGGCTGACAGTAACAGTGATT
ATCGTGCGGGTTCAGATTTTGCCCATCAGATCAAAGGCCAGGGCACCGGCAGTATCCGGAATTTTAATCC
GCAGGAGAGTATACCCGGCTATAACGCGAATCCGGATGAAACGAAATATTACGGTGGCGTGACCGCCGGT
GGTGACAGTGGGCTGAAGAATGACGGCACGACGCAGTGGGCCACAGGCGAAACCGGTAAAACCATTACAG
AATCGTTCATGAACAAGCCCAAAGATATTCTGTCACCGGATGCGCCGTTTATTGAAAAAGGAAGGGATGT
GGTGAACCGTGCCGACAGTATTGTGGGAAATACCGGGCAGCAGTGCAGCGCGCAGGAGATTAACCGCAGC
GAATTCACGAATTATACCTGTGAACGCGACACCACTGTGGAGGAATACTGTACCCGGACGGCCACCATCA
CCGGCGACTGGAGAGAGACAACAGAGGTCAGAACCTACACCCTCACCGCCTTTAGTTTCAGCCGTTCCGG
TAAGCAGATCGTTTTCAGCGTAACCGTGCCGGAAGCGGGTACGATAAGCAGCGCCAGCCTGAATGTGATC
ACACAGAATTATCTGTGGAATTCCCGTGCCGGCTTTATGAATACCATCTTCAACATGACGTGGGGCAGTA
CCATTACACTGGGTGGCGCGACGGGAATGATGCTGAGTAAGGGCCAGATTCTGAGCGGGACAAGCTGCAG
CGGGAACGGTAGCTGTACCGGGACGCTGGATGACCGCATTTTTAACGAACTGACCAGCGGGAGAACGACG
TTCACGCTGACACTGGTGATGCAGGTAAAGGACCGGGAGTGGATACCCCGGGTGGAGTGGGTGGAAAGCT
GCCCGTTTAATAAAGCGGATGGCGTGCTGAAAGGCACAGAATGCTCAGAGCCAGGTGGTACGAAAACCGG
GGTGATGGAAGGAAAACCCTGGAGCCTGACGGAGGCCTGCTGGGCATACCGCGATAAATATGTCACCCAG
TCTGCGGACAATGGCACCTGCCAGGCGTATGTGGACAATCCGGCCTGTACTCTTGCCACCCGGCAGTGCG
CGTTTTATTCCGGTGAGGGCACCTGCCTGCATGAGTACGCCACGTACTCCTGTGAGTCGAAAACGTCAGG
AAAGGTCATGATTTGTGGCGGGGATGTGTTCTGCCTCGATGGGGAATGCGATAAGGCGCAGAGCGGAAAG
AGCAATGATTTTGGCGAGGCGGTATCGCAACTGGCGGCGCTGGCGGCGGCAGGTAAAGATGTCGCGGCCC
TGAACGGTATTGACGTCCGTGCATTCACCGGACAGGCGAAATTCTGTAAGAAGGCCGCAGCCGGGTACAG
CAACTGCTGTAAGGACAGTGGCTGGGGGCAGGATATCGGTCTGGCTAAATGCAGTAGTGACGAAAAAGCT
CTGGCCAAAGCAAAAACGAACAAACTGACGGTCAGTGTCGGGGAATTCTGTTCGAAAAAGGTACTGGGTG
TCTGTCTGGAGAAGAAACGCAGCTACTGCCAGTTTGATTCGAAGCTGGCGCAGATAGTCCAGCAGCAGGG
GCGCAACGGCCAACTGCATATCAGCTTCGGCAGTTCAAAACATCCTGACTGCCGGGGTATCACCGTGGAC
GAACTGCAGCAGATTAAATTCGACCAGCTGGACCTCACGAACTTCTACGAAGACCTGATGAATAACCAGA
AAATCCCGGACAGTGGCGCGCTGACGGAGAAGGTGAAAGAACAAATTGCAGACCAACTCAGGCAGGCCGG
GAAATAA