SecReT4
Protein ID: 188535967
T4SS name [ID]Tra_F [131]
Gene symboltraB
Locus tagETA_pET450130
StrainErwinia tasmaniensis Et1/99
Repliconplasmid pET45 [GenBank: NC_010699] [Browse all T4SS(s) in this replicon]
Location [Strand]6684..8057 [+]
Productconjugal transfer pilus assembly protein TraB
Component typeTraB_F
UniProt IDB2VB09
KEGG IDeta:ETA_pET450130
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 5.8e-37, Aligned region: 190..387
Protein Sequence: 457 a.a.     [Download]
>gi|188535967|ref|YP_001911079.1| conjugal transfer pilus assembly protein TraB [Erwinia tasmaniensis Et1/99]
MGNINMLTKRKQLATLIGVLIAGSVGAGIVYLTAGDSKPAAQAIKPQSAPVSGVVTNAFTEQVQKSVLQQ
QQERTAVLEKELDDLKKQVSNQPSGESADVQVLKATVDALLKNQKASAEQNNGAHAVGEPEVKWNVQGSN
SYSSPPVFPVGQGGNNYVPPKNDPRPQIGGIQHTSFSWEHPKVKGNPLPWISSGSFINASMIEGADANAS
VTGQQSSTPVVFTLLGNASLPNGHKYNLDQCRVTGEIYGDISSERGEVRTDHISCNISGDRHVDMPFKGH
VSYQGKEGIRGKPVMRNGKIIAYAGAAGVLSGLGSGISESGTTSVGIGATATPAAGEIARQAFGGGASKA
ADTLSQYWIKRAEQYHPVIDIGAGNAVTVVFQEGFQLTTIEDEIARKSESAAGQVVDKVAGNMSADDGAR
TLSSLPPSGQQHGAIINPDDVIRKAKDLDLGSTVTSQ
 
Nucleotide Sequence: 1374 bp     [Download]
>gi|188535954|ref|NC_010699.1|:6684-8057 Erwinia tasmaniensis Et1/99 plasmid pET45, complete sequence
ATGGGTAACATTAATATGCTGACGAAGCGTAAGCAACTCGCCACGCTAATCGGTGTACTTATCGCGGGCA
GCGTTGGTGCGGGCATAGTCTATCTCACGGCAGGTGATAGTAAACCCGCCGCGCAGGCGATAAAACCCCA
AAGCGCGCCCGTTTCCGGCGTGGTTACTAATGCCTTCACAGAGCAAGTTCAGAAAAGCGTTTTGCAGCAG
CAGCAGGAGAGAACCGCGGTACTGGAAAAAGAGTTGGATGATCTCAAAAAGCAGGTGAGCAATCAGCCAT
CAGGTGAATCAGCAGATGTTCAGGTGCTTAAAGCCACGGTAGATGCTTTGTTAAAAAACCAGAAGGCGAG
TGCTGAGCAGAACAATGGCGCTCATGCTGTTGGTGAGCCAGAAGTTAAGTGGAACGTCCAGGGTTCAAAT
AGTTATTCCAGTCCCCCGGTGTTCCCAGTAGGCCAGGGTGGCAATAATTACGTCCCACCCAAAAATGATC
CACGTCCTCAGATTGGCGGCATACAGCATACCTCTTTCTCATGGGAGCACCCAAAAGTAAAGGGTAATCC
ACTGCCGTGGATTTCGTCCGGTTCATTCATCAATGCCAGTATGATCGAAGGTGCAGATGCGAACGCCAGC
GTCACCGGGCAGCAGTCATCTACACCAGTTGTGTTTACGTTACTCGGCAACGCCTCGCTACCAAACGGAC
ATAAATACAACCTCGATCAATGCCGTGTAACGGGTGAAATCTACGGCGATATTTCAAGCGAGCGCGGCGA
AGTCCGCACCGACCATATTTCCTGCAACATTTCGGGGGATCGCCACGTTGATATGCCATTCAAAGGGCAC
GTCAGCTATCAGGGCAAGGAAGGCATTCGCGGGAAGCCAGTGATGCGTAACGGAAAAATCATTGCTTACG
CAGGAGCCGCAGGCGTGCTGTCAGGGCTAGGTTCAGGTATCTCTGAATCGGGTACGACGTCAGTAGGCAT
CGGTGCTACGGCAACGCCTGCCGCAGGTGAAATTGCCCGGCAGGCATTTGGCGGCGGTGCATCTAAAGCA
GCAGATACGTTATCGCAGTACTGGATAAAACGTGCCGAACAATATCACCCAGTCATTGATATTGGCGCAG
GTAATGCCGTTACCGTTGTCTTCCAGGAAGGCTTCCAGCTCACTACGATTGAAGATGAAATTGCCCGCAA
ATCGGAATCAGCGGCAGGGCAAGTCGTTGATAAAGTAGCAGGTAACATGTCGGCAGATGATGGTGCCCGT
ACACTCAGCAGCCTTCCTCCTTCCGGTCAACAACACGGAGCCATCATTAATCCCGACGATGTAATCCGTA
AAGCTAAAGACCTCGATTTGGGCAGCACCGTAACAAGTCAGTAA