SecReT4
Protein ID: 188535971
T4SS name [ID]Tra_F [131]
Gene symboltraW
Locus tagETA_pET450170
StrainErwinia tasmaniensis Et1/99
Repliconplasmid pET45 [GenBank: NC_010699] [Browse all T4SS(s) in this replicon]
Location [Strand]11711..12322 [+]
ProductTraW protein
Component typeTraW_F
UniProt IDB2VB13
KEGG IDeta:ETA_pET450170
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 203 a.a.     [Download]
>gi|188535971|ref|YP_001911083.1| TraW protein [Erwinia tasmaniensis Et1/99]
MKLKILILLTTVSISVMAKDMGTFGQLFPIDEPDMMDLINGRLKHMDENGEMARIHEKAEKDVKAHAVRP
PPVSGVSEARQDKTWLFDPSFVADRDITDGRGHYITHKGDRKNPLDFIPFKSTLYFINGDNPAELQWVKN
KIKYSINFKIILVKGSVPETSEKLDEQIFFDQYGVMVTRFGITHTPAEVFQEGDMLRVKEQKL
 
Nucleotide Sequence: 612 bp     [Download]
>gi|188535954|ref|NC_010699.1|:11711-12322 Erwinia tasmaniensis Et1/99 plasmid pET45, complete sequence
GTGAAGCTTAAAATTCTCATCCTGTTAACGACCGTTTCGATATCCGTGATGGCTAAAGATATGGGCACCT
TCGGTCAATTATTTCCGATTGACGAGCCGGACATGATGGATTTAATCAACGGTCGCTTGAAACACATGGA
TGAAAATGGCGAAATGGCCCGCATCCATGAAAAAGCTGAAAAGGACGTTAAAGCCCACGCGGTACGTCCT
CCGCCAGTCTCAGGTGTTTCTGAAGCACGCCAGGATAAAACCTGGCTTTTCGACCCGTCATTTGTTGCAG
ACCGGGATATTACGGACGGTCGCGGTCATTATATTACGCATAAAGGAGACAGGAAAAACCCGCTGGACTT
TATCCCGTTCAAATCCACGCTGTACTTCATCAACGGGGATAACCCGGCAGAACTTCAGTGGGTGAAAAAC
AAGATTAAATACTCAATCAATTTCAAGATTATTTTGGTTAAGGGGAGCGTCCCGGAAACGAGTGAAAAGC
TCGATGAACAGATTTTCTTTGACCAATACGGCGTGATGGTGACGCGTTTTGGTATCACGCATACCCCTGC
TGAAGTTTTTCAGGAGGGCGATATGCTCAGAGTCAAGGAGCAGAAACTATGA