SecReT4
Protein ID: 188535982
T4SS name [ID]Tra_F [131]
Gene symboltraI
Locus tagETA_pET450280
StrainErwinia tasmaniensis Et1/99
Repliconplasmid pET45 [GenBank: NC_010699] [Browse all T4SS(s) in this replicon]
Location [Strand]25322..31261 [+]
ProductTraI protein
Component typeTraI_F
UniProt IDB2VB36
KEGG IDeta:ETA_pET450280
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 1.3e-72, Aligned region: 6..282
AAA_30 [PF13604], Evalue: 3.7e-42, Aligned region: 1028..1215
TraI [PF07057], Evalue: 9.9e-16, Aligned region: 1470..1581
Protein Sequence: 1979 a.a.     [Download]
>gi|188535982|ref|YP_001911094.1| TraI protein [Erwinia tasmaniensis Et1/99]
MSVQTLSSSSGAAGYYSQADNYYFVGELLTGWHGKLAEEMGLSGSVDLKTFASLLDGITPDGRKMGKNHR
PGLDLTFSAPKSLSVLALVGGDERLIQAFQESVRDTITEIESFISTRVTKDKQTSIETTGKGIFATFVHD
TSRNLDPQLHMHVLTMNITEKNGKLYSLSSDNRYGNGFMEMVYTHHTLFGTIQRNILEKKVTTLGYQTRP
TEKGLWEIQGVPVSLLGHFSSRSRDIRRAVGDSASFSSRSIAALDTRSPKQVPDRSELLNEWNAAIRDHG
FDMGEFISTAREQAQDGPALGHDDARPADAEQEQEQEQEQEQGGDTPSNPAPQQDEAAARQKQATPGTPA
VRPEDTTQLAQREHQAEKQPHMQTVSQKEKKPDAPPRNLEQDDRVIHTALSSLSNRKRDFSYTDVVLEIA
ASTENVVSLRYGEHLIDRAIETGKLIPLNDEKTRFTAQTLLIDEKVVVELARDHVANGLVSGTKKPLENL
LPELADRPVTIFTAPSTVRGVKAVIDKVISDQEDRGRSVTVLSPTASRRDQIAFATEEKMIFRDLSEPET
TFARNSTVIVDNAERMSARDSINLLSHARENNLQLVLINTAGRSSQTNVLSLFEDGGASTGKVKTEHESL
SVKVSHAPDKAQRGKDVASEYAAAFADTVRPVVVAPTAQDRRQITDDIRASLKESGGIDGLAQGVMVEAR
NEVFMTIAEKKKVASWRTGYVIEDRTERKPQVYTVGSIAEETKSLILYNDKGERSTVKASAMGRKDVRVF
ESTMIEVVPGEVLKASAALKNQGIRAKDSLRVHEASGREITGFNERTGKEFTLYTQEPVYAAYGYVSGMG
EVNRAEGTVIAALSKRDLNANNINSLNMSGSSLSIYSPLDEKATVSKIQNMNLRNTVTEYVISTAQKPDI
DAATTYLKEHVATPMAIAVNRAIAGVQEVSVYATTLLSSALKLDRRLTAAEVRNEIDSRIATGDLISLNG
GTTTTDNPRVVPRATYEVEKDILGMVTAGYATKQPLVIRVEEGKLDHLTAGQKGATGDILTGTDTFQFVQ
GFAGVGKTTKLTTLQSVLNELLPGLEIRGIGPTHRAVGEMSGAGIHAQTAKSFVLDSLKDEANGVKQDHR
NTLFIVDEASMVGNSDMRDTLGLIDRAGGRAVVIGDRQQFLPIESGAPFQLAQERTPARLSVMQDIVRQT
NLALREAVYSTINGDHSGSLRQLEAISNDLVPRREVYRENPRFSGASLQGNASSSTVAEDYLSRTDEARA
GTMVITGTNKIRREINDLIQQGLVQDGSLSAARHVDVSVYSQILLPSTAFHDPDSWIRGRVVINDSAYFR
VEKVGNEGVTVRHMDSGLHQEWDYRGLDSTRMEMFDVEQTRFLEGDRVLLRKTDIDTGKTSNEAYRIQAI
RDNGQIVLEGKSGVRQIDPALTAQDRHIDLGYAVTSTGAQGASARYDIGFMGTEGAESRLTNARAYYILI
SRAKEHAQIYTDNTPAKLEAAIGINREPKHTAHDLLHARKDASHAQTLSQFAASLDTFYAGRVLAESFSL
DIGTSALKLLSRTPTAPLRVMLPAYDYNGKVSGVNTWALAAARGEFSLGEQQTQTESNTLFSVVQRGNTP
EVLSAGTLSDALTLAGKNPQASVILAPEGYEQHSVVLDVLNVDRITSTMIDEVTRFTEETPEQTVNADDL
PEPAQITADTTYDMPAENDTNNGQAIDTDMPDYGDMNGYDDAPEMDTDWQEYSDIMDDSTPELPDTDLPE
PQAPTAPDTTLPELPGADLPELSLPEPDAPTAPDTTLPELPGADLPELSLPEPDAPTVPGLPDTALPELP
GADLPELSVPELATPTAPDVADNLPEYSVTELADTALPELSLPEPDAPTVPGLPDTALPELPGADLPELT
VPELTVPGLSSMEGPDIALPAGEVSALSVGDLTLPELNAPAPDISLPESAPESLDSITALGPDERENYDP
TLRHDLGEFEISKTIDKDI
 
Nucleotide Sequence: 5940 bp     [Download]
>gi|188535954|ref|NC_010699.1|:25322-31261 Erwinia tasmaniensis Et1/99 plasmid pET45, complete sequence
ATGTCAGTTCAGACCCTGTCCAGCTCATCCGGCGCGGCAGGCTATTACAGCCAGGCAGACAACTATTACT
TTGTGGGGGAACTGCTGACCGGGTGGCACGGTAAGCTGGCGGAAGAAATGGGGCTGTCCGGCAGCGTGGA
TTTGAAAACCTTCGCCAGCCTGCTGGACGGCATAACGCCGGACGGCAGGAAGATGGGTAAAAATCACCGT
CCCGGCCTCGACCTGACGTTTTCCGCGCCGAAAAGCCTCAGCGTTCTGGCGCTGGTCGGCGGGGATGAGC
GTCTTATCCAAGCGTTCCAGGAGTCGGTGCGCGATACCATCACCGAAATTGAATCCTTTATCTCGACCCG
CGTCACGAAGGACAAACAGACGTCGATAGAGACGACCGGGAAGGGCATTTTTGCCACTTTCGTACACGAT
ACCAGTCGCAATCTCGATCCGCAGTTACACATGCACGTCCTGACCATGAACATTACCGAGAAGAACGGCA
AGCTGTATTCCCTGTCGTCTGATAATCGCTACGGCAACGGGTTTATGGAAATGGTGTACACGCACCATAC
GCTTTTCGGCACGATTCAGCGCAATATCCTGGAGAAAAAGGTCACGACGCTGGGCTATCAAACCCGGCCC
ACCGAAAAAGGGCTGTGGGAAATCCAGGGTGTTCCGGTAAGCCTGCTGGGGCATTTTTCATCGCGCAGCC
GCGATATCCGCCGTGCGGTCGGGGATTCTGCTTCATTTTCAAGCCGCAGCATTGCCGCGCTCGATACCCG
TTCGCCCAAGCAAGTGCCCGACCGTTCGGAACTGCTGAACGAATGGAACGCCGCCATTCGCGATCACGGC
TTTGATATGGGTGAGTTCATCAGCACCGCCAGAGAGCAGGCGCAGGACGGCCCGGCACTGGGCCACGATG
ACGCCCGCCCGGCAGACGCGGAGCAGGAGCAGGAGCAGGAGCAGGAGCAGGAGCAGGGCGGCGATACGCC
AAGCAACCCCGCACCGCAACAGGATGAAGCCGCAGCGCGTCAGAAACAGGCAACGCCCGGCACTCCCGCA
GTGCGCCCGGAAGACACGACCCAACTGGCACAGCGTGAGCATCAGGCGGAAAAACAGCCGCATATGCAGA
CCGTTAGCCAGAAGGAAAAAAAACCGGACGCGCCGCCAAGAAATCTGGAGCAGGACGACCGCGTGATCCA
CACGGCCCTGTCTTCCCTCAGCAACCGCAAGCGTGACTTCAGCTATACCGATGTGGTGCTTGAGATTGCC
GCCAGTACCGAAAACGTGGTGTCACTGCGATACGGCGAGCACCTGATTGACCGGGCCATCGAAACTGGGA
AGCTGATCCCACTGAACGATGAGAAGACCCGATTCACCGCGCAGACCCTGCTGATTGATGAAAAAGTGGT
TGTGGAACTGGCCCGCGACCACGTTGCCAATGGCCTGGTGTCCGGTACTAAAAAACCGCTGGAAAACCTG
CTGCCCGAACTGGCAGACCGCCCCGTGACCATCTTCACTGCCCCCTCGACGGTGCGGGGCGTGAAGGCGG
TGATCGATAAGGTTATCAGTGACCAAGAAGACCGTGGGCGCAGCGTGACGGTGCTGTCCCCGACTGCCAG
CCGCCGCGATCAGATTGCCTTTGCGACCGAAGAAAAAATGATTTTCCGCGACCTGAGCGAGCCTGAAACC
ACGTTTGCCCGGAACTCCACGGTGATCGTGGATAACGCCGAGCGGATGAGCGCCCGCGACTCGATTAACC
TGCTGAGCCACGCACGGGAAAACAACCTGCAACTGGTGCTGATTAACACCGCAGGCCGCAGCTCGCAGAC
CAACGTGCTGAGCCTGTTTGAAGACGGCGGGGCGTCAACCGGGAAGGTGAAAACCGAGCATGAAAGCCTG
AGCGTGAAGGTTTCGCACGCGCCTGATAAGGCGCAGCGCGGGAAGGACGTTGCCAGCGAGTACGCGGCTG
CCTTTGCCGACACGGTGCGCCCGGTCGTCGTGGCCCCGACGGCGCAGGACAGGCGTCAGATTACCGACGA
TATCCGTGCCTCGCTGAAGGAGAGCGGGGGGATTGACGGACTGGCGCAGGGCGTCATGGTGGAAGCCCGT
AACGAAGTCTTTATGACCATTGCCGAAAAGAAAAAGGTCGCTAGCTGGCGTACCGGATACGTCATTGAAG
ACCGCACCGAGCGCAAGCCGCAGGTGTACACTGTAGGGAGCATTGCGGAAGAAACGAAGTCCCTGATCCT
CTACAACGACAAGGGCGAGAGATCGACCGTCAAAGCGTCCGCAATGGGGCGTAAAGACGTGCGCGTGTTT
GAGTCCACCATGATTGAAGTCGTGCCCGGCGAAGTGCTAAAAGCCTCTGCCGCGCTCAAAAATCAGGGTA
TCCGGGCGAAAGACAGCCTGCGCGTCCATGAGGCATCCGGGCGGGAAATCACTGGCTTTAACGAGCGCAC
GGGCAAAGAGTTCACGCTTTACACCCAGGAACCCGTGTACGCGGCCTATGGCTACGTCAGCGGCATGGGC
GAAGTGAACCGCGCCGAAGGCACCGTGATCGCCGCGCTCAGCAAACGCGACCTGAACGCCAACAACATCA
ATTCACTCAACATGTCCGGCAGCAGCCTGTCCATCTATTCGCCGCTCGATGAGAAGGCCACCGTCAGCAA
AATTCAGAACATGAACCTGCGCAACACGGTCACGGAGTACGTGATCAGCACCGCGCAGAAGCCGGACATT
GACGCCGCCACCACCTACCTGAAGGAGCATGTGGCCACACCGATGGCCATCGCGGTCAATCGCGCTATTG
CGGGCGTCCAGGAGGTATCTGTTTATGCGACAACCCTGCTCAGCAGCGCCCTGAAACTGGACAGGCGTCT
GACGGCGGCAGAGGTGAGAAATGAAATCGACAGCCGCATTGCGACCGGCGACCTGATCAGCCTCAATGGC
GGCACGACGACGACTGACAACCCCCGTGTTGTACCCCGCGCCACGTATGAGGTGGAGAAAGACATTTTAG
GCATGGTCACTGCCGGATACGCCACCAAGCAGCCGCTCGTCATACGCGTTGAAGAGGGCAAGCTCGATCA
CCTGACGGCAGGCCAGAAAGGGGCTACGGGCGACATTCTGACGGGCACGGACACCTTCCAGTTCGTTCAG
GGCTTCGCGGGCGTGGGGAAAACCACCAAGCTCACCACGCTGCAATCGGTGCTCAATGAGTTGTTACCCG
GTCTGGAAATTCGCGGGATTGGCCCGACACACCGCGCCGTGGGCGAAATGTCCGGGGCTGGCATCCACGC
ACAGACGGCAAAATCCTTTGTACTGGACTCACTCAAGGATGAAGCCAACGGCGTGAAGCAGGATCACCGT
AACACGCTGTTTATCGTGGATGAGGCCAGTATGGTTGGCAACAGCGACATGCGCGACACGCTGGGCCTGA
TTGACCGTGCCGGAGGCCGTGCCGTGGTCATCGGCGACCGACAGCAGTTTCTTCCCATCGAGAGCGGAGC
ACCGTTTCAGCTCGCCCAAGAGCGCACACCTGCCCGCCTGTCCGTGATGCAGGACATTGTGCGCCAGACC
AACCTGGCGCTGCGTGAGGCCGTCTACAGCACGATTAACGGCGATCACAGCGGCAGCCTTCGCCAGCTAG
AAGCCATCAGCAACGACCTGGTGCCGCGCCGTGAGGTATACCGCGAAAATCCGCGCTTCAGTGGCGCGTC
CCTTCAGGGCAATGCCTCATCCTCGACCGTGGCGGAAGATTACCTGAGCCGCACCGACGAGGCCCGCGCC
GGTACGATGGTGATCACGGGAACCAACAAAATCAGGCGTGAAATTAACGACCTGATCCAACAGGGGCTGG
TGCAGGACGGTAGCCTGTCAGCCGCCCGCCACGTCGATGTGTCGGTGTACTCACAGATACTGCTACCCAG
CACGGCATTTCACGATCCTGATTCGTGGATAAGAGGCCGGGTGGTCATCAACGACAGTGCTTATTTTCGG
GTAGAGAAGGTCGGCAATGAAGGCGTGACGGTAAGGCACATGGACAGCGGGCTGCATCAGGAATGGGACT
ATCGCGGACTGGACAGCACGCGGATGGAGATGTTCGACGTTGAGCAAACCCGCTTCCTAGAGGGGGATCG
CGTACTGCTGCGCAAAACGGATATCGACACCGGAAAGACCAGCAACGAGGCATACCGGATTCAGGCCATC
CGCGATAACGGGCAAATCGTGCTTGAAGGCAAATCCGGCGTGCGCCAGATCGATCCGGCCTTAACCGCCC
AGGACAGGCACATTGACCTGGGCTATGCCGTGACCAGTACGGGCGCACAGGGGGCCAGTGCCCGCTACGA
TATCGGGTTTATGGGCACTGAGGGCGCAGAGTCCCGCCTGACCAACGCCCGCGCCTACTACATCCTGATT
TCACGCGCCAAAGAGCACGCGCAGATTTACACCGACAACACGCCCGCGAAGCTGGAGGCGGCTATAGGCA
TCAACCGCGAGCCGAAGCACACAGCCCATGACCTGCTGCACGCCCGGAAGGACGCCAGCCACGCACAGAC
GTTGTCTCAGTTCGCCGCGTCACTCGATACCTTCTACGCCGGGCGCGTGCTGGCAGAGTCGTTCAGCCTC
GATATCGGGACCAGCGCACTGAAGCTGCTTTCCCGCACGCCGACCGCGCCGCTGCGCGTGATGCTGCCTG
CCTATGACTATAACGGCAAGGTATCCGGTGTGAACACCTGGGCGCTTGCCGCTGCGCGGGGCGAGTTCAG
CCTGGGCGAACAGCAGACTCAGACCGAAAGTAACACCCTTTTCAGCGTTGTGCAGCGGGGCAACACGCCG
GAGGTGCTTTCGGCAGGCACGCTGTCTGACGCCCTGACTCTTGCCGGGAAAAACCCGCAGGCCAGTGTGA
TTCTCGCGCCGGAAGGCTATGAACAGCACAGCGTGGTGCTCGATGTGCTGAACGTGGATCGTATCACATC
AACGATGATTGATGAGGTTACGCGCTTCACAGAAGAAACACCTGAGCAGACGGTAAATGCCGACGATCTG
CCTGAGCCTGCACAGATTACAGCCGATACCACTTATGACATGCCCGCTGAAAACGATACAAATAACGGGC
AGGCGATTGATACGGACATGCCGGATTATGGCGATATGAATGGCTACGATGACGCGCCGGAAATGGATAC
GGACTGGCAGGAATACAGCGACATAATGGATGACAGCACGCCGGAACTGCCGGACACCGACCTGCCGGAG
CCGCAGGCACCGACCGCGCCGGATACCACGCTGCCGGAGCTGCCGGGTGCAGACCTGCCGGAACTGTCAC
TGCCGGAGCCAGACGCCCCGACCGCGCCGGATACCACGCTGCCGGAGCTGCCGGGTGCAGACCTGCCGGA
ACTGTCACTGCCGGAGCCAGACGCCCCGACCGTGCCGGGCCTGCCAGACACCGCGCTGCCGGAGCTGCCG
GGTGCAGACCTGCCGGAACTTTCCGTGCCGGAACTGGCGACACCCACCGCGCCGGACGTGGCGGACAACC
TGCCGGAATACAGCGTGACGGAACTGGCGGACACCGCGCTGCCAGAGCTGTCACTGCCGGAGCCAGACGC
CCCGACCGTGCCGGGCCTGCCAGACACCGCGCTGCCGGAGCTGCCGGGTGCAGACCTGCCGGAACTGACC
GTGCCGGAACTGACCGTGCCGGGACTCAGCAGCATGGAAGGGCCAGACATTGCCCTGCCAGCCGGAGAAG
TTTCAGCCCTGAGTGTCGGTGATCTAACGCTGCCGGAACTGAACGCCCCGGCACCGGATATCAGCCTGCC
TGAGTCCGCCCCGGAGTCGTTGGACAGCATCACCGCGCTGGGGCCGGACGAGCGGGAAAATTACGATCCA
ACGCTCAGGCATGACCTAGGTGAATTCGAAATCAGCAAAACCATAGACAAGGACATTTAA