SecReT4
Protein ID: 188574142
T4SS name [ID]Tra_F [94]
Gene symboltraB
Locus tagEc53638_A0124
StrainEscherichia coli 53638 plasmid p53638_226 (NC_010719)
Repliconplasmid p53638_226 [GenBank: NC_010719] [Browse all T4SS(s) in this replicon]
Location [Strand]96619..98046 [-]
Productconjugal transfer pilus assembly protein TraB
Component typeTraB_F
UniProt IDB2U5R6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 6.9e-40, Aligned region: 213..409
CALCOCO1 [PF07888], Evalue: 1e-05, Aligned region: 68..121
Protein Sequence: 475 a.a.     [Download]
>gi|188574142|ref|YP_001919188.1| type IV secretion-like conjugative transfer system protein TraB [Escherichia coli 53638]
MASINTIVKRKQYLWLGIVVVGAASAIGGVLYLSDVDMSGNGEAVAEQEPVPDMTGVVDTTFDDKVRQHA
TTEMQVTAAQMQKQYEEIRRELDVLNKQRGDDQRRIEKLGQDNATLAEQVKALGANPVTATGEPVPQMPA
SPPGPEGEPQPGNTPVSFPPQGSVAVPPPTAFYPGNGVTPPPQVTYQSVPVPGRIQRKVFTRNEGKQGPS
LPYIPSGSFAKAMLIEGADANASVTGNESTVPMQLRITGLVEMPNSKTYDATGCFVGLEAWGDVSSERAI
VRTRNISCLKDGKTIDMPIKGHVSFRGKNGIKGEVVMRNGKILGWAWGAGFVDGIGQGMERASQPAVGLG
ATAAYGAGDVLKMGIGGGASKAAQTLSDYYIKRAEQYHPVIPIGAGNEVTVVFQDGFQLKTVEEMALERT
QNRAEEDNPESPVPVPPSAESHLNGFNTDQMLKQLGNLNPQQFMSGSQGGGNDGK
 
Nucleotide Sequence: 1428 bp     [Download]
>gi|188573899|ref|NC_010719.1|:c98046-96619 Escherichia coli 53638 plasmid p53638_226, complete sequence
ATGGCCAGTATCAATACCATTGTGAAACGCAAGCAGTACCTGTGGCTGGGGATTGTGGTTGTCGGTGCAG
CCTCCGCGATTGGCGGTGTACTGTATCTGTCTGATGTGGACATGTCCGGTAACGGTGAGGCGGTGGCTGA
ACAGGAGCCTGTGCCGGATATGACCGGTGTGGTGGATACGACCTTTGATGACAAGGTGCGTCAGCATGCC
ACCACAGAGATGCAGGTGACGGCAGCGCAGATGCAGAAGCAGTATGAGGAAATCCGTCGTGAGCTGGATG
TTCTGAACAAACAGCGCGGTGATGACCAGCGTCGTATTGAAAAGCTGGGACAGGACAATGCTACCCTGGC
AGAGCAGGTGAAAGCCCTGGGTGCAAATCCCGTCACGGCGACCGGTGAGCCTGTACCGCAGATGCCTGCC
TCACCGCCCGGCCCGGAAGGCGAACCACAGCCAGGAAACACCCCCGTATCCTTCCCGCCGCAGGGCAGCG
TTGCTGTTCCACCGCCGACGGCGTTTTATCCCGGGAATGGTGTCACGCCACCACCACAGGTGACGTACCA
GTCTGTGCCGGTGCCTGGCCGGATACAGCGTAAGGTGTTTACCCGTAATGAGGGAAAACAGGGACCATCG
CTGCCGTACATTCCGTCAGGAAGTTTTGCGAAAGCCATGCTGATTGAAGGAGCGGATGCCAATGCCTCAG
TCACCGGTAATGAATCCACGGTGCCGATGCAGCTGCGTATCACCGGCCTGGTGGAAATGCCGAACAGCAA
AACGTATGACGCAACGGGATGTTTTGTGGGGCTGGAAGCCTGGGGGGATGTCTCCAGTGAGCGTGCCATC
GTGCGTACCCGCAATATCAGCTGCCTGAAGGACGGCAAAACTATTGATATGCCGATTAAGGGGCATGTCA
GCTTCCGGGGCAAAAACGGTATCAAGGGCGAAGTGGTGATGCGTAACGGCAAAATCCTCGGCTGGGCATG
GGGCGCGGGATTTGTTGACGGTATCGGTCAGGGAATGGAGCGCGCTTCCCAGCCGGCTGTCGGGCTGGGG
GCCACTGCCGCTTATGGGGCCGGCGATGTCCTTAAAATGGGTATCGGTGGCGGTGCATCGAAAGCCGCAC
AGACGCTCAGTGACTACTACATCAAACGTGCCGAACAGTATCACCCGGTGATACCGATTGGTGCGGGCAA
CGAAGTGACCGTGGTGTTCCAGGACGGCTTCCAGCTGAAAACCGTGGAAGAGATGGCGCTGGAGCGCACG
CAGAACAGAGCGGAAGAAGACAATCCGGAAAGTCCGGTTCCTGTTCCGCCATCAGCTGAAAGTCATCTTA
ACGGCTTTAATACTGACCAGATGCTGAAGCAGCTGGGCAACCTGAATCCGCAGCAGTTTATGTCCGGCAG
CCAGGGAGGGGGCAACGATGGCAAATAA