SecReT4
Protein ID: 189017128
T4SS name [ID]VirB [784]
Gene symboltraC
Locus tagETA_pET490070
StrainErwinia tasmaniensis Et1/99
Repliconplasmid pET49 [GenBank: NC_010697] [Browse all T4SS(s) in this replicon]
Location [Strand]3593..3880 [+]
ProductTraC protein
Component typeVirB2
UniProt IDB2VB01
KEGG IDeta:ETA_pET490070
PDB IDNA
Domain hit(s) vs Pfam tRNA_iecd [PF12858], Evalue: 7.2e-05, Aligned region: 46..88
Protein Sequence: 95 a.a.     [Download]
>gi|189017128|ref|YP_001909445.1| TraC protein [Erwinia tasmaniensis Et1/99]
MNTRSGFLNAICLSLLFISMGVLAGGLDSGTDALTNIKTWIFAILGIAALIYLAYCIIWAFMEKKSWSDV
GVALLQVICAGGALVAGNWGLSLMA
 
Nucleotide Sequence: 288 bp     [Download]
>gi|189017121|ref|NC_010697.1|:3593-3880 Erwinia tasmaniensis Et1/99 plasmid pET49, complete sequence
ATGAACACACGTAGTGGTTTTTTAAATGCTATATGTTTATCACTGCTTTTTATCTCTATGGGGGTTCTCG
CTGGGGGGCTGGACAGTGGTACTGACGCATTAACAAACATTAAAACATGGATATTTGCTATCCTTGGGAT
CGCAGCATTAATTTATCTTGCTTATTGTATTATATGGGCATTCATGGAAAAGAAAAGCTGGAGCGATGTG
GGCGTGGCACTATTGCAAGTTATTTGCGCTGGCGGGGCGTTGGTGGCTGGGAACTGGGGCTTAAGCCTCA
TGGCATAA