SecReT4
Protein ID: 189183118
T4SS name [ID]Tra_F [567]
Gene symbol-
Locus tagOTT_0211
StrainOrientia tsutsugamushi str. Ikeda
Repliconchromosome [GenBank: NC_010793] [Browse all T4SS(s) in this replicon]
Location [Strand]201923..203614 [-]
Productconjugative transfer protein TraN
Component typeTraN_F
UniProt IDB3CS76
KEGG IDott:OTT_0211
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 1.6e-63, Aligned region: 271..513
Protein Sequence: 563 a.a.     [Download]
>gi|189183118|ref|YP_001936903.1| conjugative transfer protein TraN [Orientia tsutsugamushi str. Ikeda]
MRLLSILTLITLNISCCLASMQNDYNEAKNYNVNLGNSSNTQELFHQSSNVNYPNNDEDLTYHGHNQLGT
ESGAMLFQAENSKNNALTQHNINDQNYMIANSMRIESDPLSALDSSNFVTQTSTTNTEIIQSCTEGSKFN
IELIRELNVECRLENVWLPWQSRQMEFAKKEIVKNHSNWLKSRSDVYDKSGAQIYCLVDDPEAIERQMKM
AIANRLGVPTQHIGRNFLLHEKNEICILEYDYRDKTQELREVAEYWKVLNPELEQLTESNECYEVNRINY
DGGDRVFFDKFRVNRPYWKQKIVFSCTSDPKDGCKHLKIQNCELKNSTCQKSVANICLLWQHDYSCSTEK
QTMLHSSLRNNSIFCLGGNCNTPTIIPNRDIAKVAHLAMLNQMSKDIKTNPVSVFSGKHRKCKKDVFSFL
NCCSSMTGWGRDIGLSQCKSKEQELALYRKKGYCYYIGTYCSSRIPILGICLARKSTYCCFQSKLARIFQ
EEARKQLKMNFGTPECPKCRGLTVEELQKVDFTKINMDELFGDILTKAQNSMNKDIIAGIKDKVHRMQQN
RSY
 
Nucleotide Sequence: 1692 bp     [Download]
>gi|189182907|ref|NC_010793.1|:c203614-201923 Orientia tsutsugamushi str. Ikeda, complete genome
ATGAGATTATTATCTATATTAACTTTAATAACGCTCAATATTAGCTGTTGTTTAGCTTCAATGCAGAACG
ACTATAATGAAGCTAAAAACTATAATGTAAATCTTGGAAATTCTTCAAATACACAAGAATTATTTCATCA
AAGTAGTAATGTCAATTATCCTAATAATGATGAGGATTTAACCTATCATGGCCATAATCAGCTTGGTACA
GAAAGTGGGGCAATGTTATTTCAAGCTGAAAACAGTAAAAACAATGCCTTAACTCAACATAATATCAACG
ATCAAAATTATATGATAGCTAATTCAATGAGAATTGAATCTGATCCTTTAAGTGCCCTTGATAGCAGTAA
TTTCGTAACTCAGACAAGTACAACTAATACTGAAATCATTCAAAGCTGTACTGAAGGCAGTAAGTTCAAT
ATTGAACTTATTCGAGAATTAAATGTTGAGTGCAGATTAGAGAATGTATGGCTTCCATGGCAAAGCCGGC
AAATGGAATTTGCAAAAAAAGAAATAGTGAAGAATCATAGCAATTGGCTTAAGAGTCGTAGCGATGTCTA
TGATAAATCAGGGGCGCAAATATACTGCCTAGTAGATGATCCCGAAGCAATTGAAAGACAAATGAAAATG
GCTATTGCTAATAGGCTCGGTGTACCTACACAGCATATTGGTAGAAATTTTTTATTACATGAAAAAAATG
AAATATGTATACTTGAATATGACTACAGAGATAAGACTCAAGAACTAAGGGAAGTAGCAGAATATTGGAA
AGTTTTAAACCCTGAACTTGAGCAATTAACAGAAAGTAACGAATGCTATGAGGTCAATCGAATCAACTAT
GATGGTGGTGATAGAGTATTTTTTGACAAGTTTAGAGTTAATCGTCCATATTGGAAACAAAAGATTGTTT
TTTCTTGTACTAGCGATCCAAAAGATGGTTGCAAACACCTTAAAATTCAAAATTGCGAATTAAAAAATAG
CACTTGCCAAAAATCGGTAGCAAATATTTGTTTACTATGGCAGCACGATTATAGCTGTTCAACTGAGAAG
CAAACAATGCTACACTCATCATTGCGTAATAACTCAATCTTTTGTTTAGGAGGTAATTGCAACACTCCAA
CTATTATACCAAACAGGGATATAGCTAAAGTAGCTCATCTAGCGATGCTAAATCAGATGAGCAAAGACAT
TAAAACAAATCCCGTTTCTGTATTTTCAGGTAAACATCGCAAATGCAAAAAAGATGTATTTAGTTTTTTG
AATTGCTGCTCTTCAATGACTGGCTGGGGGCGTGATATAGGCTTATCACAATGCAAATCTAAAGAACAAG
AATTAGCTCTATATAGAAAAAAAGGTTACTGCTACTATATTGGAACCTACTGTTCTTCAAGAATTCCGAT
ATTGGGTATTTGCTTAGCTAGAAAGTCTACTTATTGCTGCTTTCAGTCGAAACTTGCTAGAATTTTTCAG
GAAGAAGCAAGAAAACAGCTAAAAATGAACTTTGGAACACCTGAATGTCCAAAGTGTAGAGGACTAACTG
TTGAAGAATTACAAAAAGTTGATTTCACTAAAATCAATATGGATGAACTATTTGGCGATATACTCACTAA
GGCTCAAAACAGCATGAACAAAGACATTATTGCAGGCATCAAAGATAAAGTTCATCGTATGCAACAAAAC
AGATCTTATTGA