SecReT4
Protein ID: 189183125
T4SS name [ID]Tra_F [567]
Gene symbol-
Locus tagOTT_0218
StrainOrientia tsutsugamushi str. Ikeda
Repliconchromosome [GenBank: NC_010793] [Browse all T4SS(s) in this replicon]
Location [Strand]208347..209165 [-]
Productconjugative transfer protein TraB
Component typeTraB_F
UniProt IDB3CS83
KEGG IDott:OTT_1705, ott:OTT_0218, ott:OTT_1908, ott:OTT_1500
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.1e-22, Aligned region: 106..238
Protein Sequence: 272 a.a.     [Download]
>gi|189183125|ref|YP_001936910.1| conjugative transfer protein TraB [Orientia tsutsugamushi str. Ikeda]
MRAKWTEEILNEVKTLKDRLESVIESRYLETTAQINNFNQKLEILENQPKQSLYNNDSDEFSSDLNHHIL
NSPHDNKTEQAPVVVVKPYVNLRRAGSEPKKNVENYVTSGSSARAVLLIEVVVGTGTNSSSSPEPIVLQL
LDTAILYDKYKTDQIKKAILIGSCNGEMSSERAKCRIETLSVVNNQGDIIEKKVEGWLIGEDGRSGIKGI
VVDKSSNIAGMAALNGVFSSIAKFLQSKAIKPDMLPTLNLVAGGQQQEFQIGEVSVWSLRWS
 
Nucleotide Sequence: 819 bp     [Download]
>gi|189182907|ref|NC_010793.1|:c209165-208347 Orientia tsutsugamushi str. Ikeda, complete genome
TTGAGAGCAAAATGGACAGAGGAAATACTTAATGAAGTCAAAACATTAAAAGATAGATTAGAAAGTGTAA
TAGAAAGCAGATATTTAGAGACTACAGCCCAAATTAATAATTTTAACCAAAAACTTGAGATATTGGAGAA
TCAGCCTAAACAGAGTCTATATAATAATGATAGTGATGAATTTAGTTCTGATCTTAATCATCATATTTTA
AATTCACCACATGATAACAAAACAGAGCAAGCTCCTGTAGTAGTAGTAAAGCCTTATGTAAATCTTAGGA
GAGCTGGATCTGAGCCAAAAAAAAATGTTGAGAACTATGTTACTAGCGGTAGTTCTGCTAGAGCTGTGCT
ACTTATTGAAGTCGTTGTAGGTACTGGAACTAATAGCTCTTCATCACCAGAACCAATTGTTCTGCAGTTG
CTTGATACAGCAATTCTTTATGATAAATATAAAACTGATCAAATCAAAAAGGCAATTTTAATTGGATCCT
GTAACGGAGAGATGTCCTCAGAGAGAGCTAAATGTCGCATCGAAACTCTTTCAGTAGTCAATAACCAAGG
AGATATTATCGAGAAAAAGGTGGAAGGCTGGTTGATAGGCGAAGACGGACGTTCTGGAATTAAAGGAATC
GTGGTGGATAAATCGTCTAACATAGCAGGCATGGCTGCATTAAATGGAGTATTTAGCAGTATAGCTAAGT
TTCTGCAATCTAAGGCTATTAAACCTGATATGCTACCAACGTTAAACCTAGTAGCTGGAGGCCAACAACA
AGAGTTTCAGATTGGAGAGGTTTCAGTCTGGAGCTTACGCTGGAGCTAG