SecReT4
Protein ID: 189184059
T4SS name [ID]Tra_F [564]
Gene symbol-
Locus tagOTT_1152
StrainOrientia tsutsugamushi str. Ikeda
Repliconchromosome [GenBank: NC_010793] [Browse all T4SS(s) in this replicon]
Location [Strand]1183804..1184073 [-]
Productconjugative transfer protein TraB
Component typeTraB_F
UniProt IDB3CQH5
KEGG IDott:OTT_0705, ott:OTT_0098, ott:OTT_1706, ott:OTT_1499, ott:OTT_0217, ott:OTT_1152, ott:OTT_0484
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.2e-09, Aligned region: 6..52
Protein Sequence: 89 a.a.     [Download]
>gi|189184059|ref|YP_001937844.1| conjugative transfer protein TraB [Orientia tsutsugamushi str. Ikeda]
MERFQSGAYAGASNAFDKLADFAIKRADSMSPVVLIASGRVIDVVFKKGFDLCEHKKKPHNSTYSQSTNN
EKVNLHNKFDQSQKLEEHL
 
Nucleotide Sequence: 270 bp     [Download]
>gi|189182907|ref|NC_010793.1|:c1184073-1183804 Orientia tsutsugamushi str. Ikeda, complete genome
TTGGAGAGGTTTCAGTCTGGAGCTTACGCTGGAGCTAGCAATGCTTTTGATAAGCTAGCTGATTTTGCTA
TAAAACGAGCTGATTCTATGAGCCCAGTCGTTCTTATTGCGTCAGGTAGAGTCATAGATGTTGTATTTAA
AAAAGGTTTTGACTTATGCGAGCACAAGAAGAAGCCACATAATTCAACTTATTCACAATCAACTAACAAT
GAAAAAGTTAATTTGCATAATAAATTCGATCAATCACAAAAGTTAGAGGAGCATTTATAA