SecReT4
Protein ID: 189348791
T4SS name [ID]Tra_F [805]
Gene symboltraN
Locus tagBMULJ_06205
StrainBurkholderia multivorans ATCC 17616
Repliconplasmid pTGL1 [GenBank: NC_010802] [Browse all T4SS(s) in this replicon]
Location [Strand]40018..41421 [+]
Productconjugal transfer mating pair stabilization protein TraN
Component typeTraN_F
UniProt IDB3DCT9
KEGG IDbmj:BMULJ_06205
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 3.4e-28, Aligned region: 68..210
TraN [PF06986], Evalue: 3.4e-28, Aligned region: 335..401
Protein Sequence: 467 a.a.     [Download]
>gi|189348791|ref|YP_001941986.1| conjugal transfer mating pair stabilization protein TraN [Burkholderia multivorans ATCC 17616]
MLITRIRRLFTSLVVTVLSLPLPTTAQTYGPGACSPVPGSQTCIDTTPCKTSGTGQQICLSTATPPAGAL
QVPYSCWQYSYSYACTGTTVDTCGQYRSNSACGVVGSVCNDTIAETGQCDEWTYTYRCQTKAEQTGQQMN
CSNGLFDNSGFPTPPNNNNSFLTGAIGLELLGEAQKYTDGNSIFAGVEESCRKGYEGIQNCCKSTPGAQS
NNMVMTAAIGAAGSVAKYAGEKLIDLASPYVFDAMYTNGIFSEALTQNFTTAFSLDAANGGGTLGTQLAS
GGIQFGVYGFTVGFGTMTPGLFGANMQLASFGSNGYLAFNPYVFAAMVAIQVIQGLSKCSQGEQLLALHK
GAGLSTFIKEECAKKALGACVQYVDTYCSFNSQLAQIINIQGKTQLGLPLEGCSGLTPDQISKIDFKKID
FSAFSSQMMDQAMKGLPKNITGNYTPIMQNTPSGSSQKGGSAVLPTY
 
Nucleotide Sequence: 1404 bp     [Download]
>gi|189348761|ref|NC_010802.1|:40018-41421 Burkholderia multivorans ATCC 17616 plasmid pTGL1, complete sequence
ATGCTGATTACCCGTATTCGACGCCTCTTCACTTCGCTGGTCGTCACGGTGCTTTCCCTTCCCCTGCCGA
CAACGGCACAAACCTATGGCCCCGGCGCATGTTCCCCCGTCCCAGGGTCGCAGACTTGCATCGACACGAC
GCCGTGCAAAACGTCAGGCACTGGTCAGCAAATTTGCCTTTCCACTGCGACGCCGCCCGCAGGCGCACTG
CAGGTCCCTTATAGCTGCTGGCAGTACTCCTACAGTTACGCTTGCACCGGCACCACCGTCGACACCTGCG
GTCAGTACCGCAGCAACTCAGCCTGCGGCGTGGTCGGTAGCGTTTGCAATGATACGATCGCCGAAACTGG
GCAGTGCGACGAATGGACGTATACCTACCGTTGTCAAACCAAGGCCGAGCAGACTGGCCAACAGATGAAT
TGCTCGAACGGTCTGTTTGACAACAGCGGCTTTCCGACGCCGCCGAACAACAACAACTCGTTCCTGACGG
GAGCAATCGGGCTCGAACTGCTCGGTGAGGCACAGAAGTACACCGACGGCAATAGCATCTTCGCCGGGGT
CGAGGAAAGCTGCAGAAAGGGTTACGAAGGAATCCAGAATTGCTGCAAGAGTACCCCTGGCGCGCAATCG
AACAACATGGTAATGACAGCGGCCATCGGCGCAGCTGGTTCGGTCGCCAAGTATGCCGGCGAGAAGCTGA
TTGATCTCGCGTCGCCATACGTGTTCGACGCGATGTATACGAACGGAATTTTCTCCGAGGCGCTGACGCA
GAACTTCACGACAGCATTCTCTCTTGATGCGGCCAATGGCGGCGGAACACTCGGTACTCAACTCGCTTCT
GGCGGCATACAGTTCGGCGTATATGGTTTCACGGTCGGGTTCGGAACGATGACCCCAGGGCTTTTCGGCG
CGAACATGCAACTGGCTTCCTTCGGCTCCAACGGATACCTCGCGTTTAACCCATATGTCTTCGCTGCGAT
GGTTGCAATTCAGGTCATCCAAGGCCTATCGAAGTGCTCGCAGGGCGAGCAGCTCCTGGCGCTTCATAAG
GGTGCCGGTCTAAGCACGTTCATCAAAGAGGAGTGTGCCAAGAAGGCGCTGGGTGCCTGCGTTCAATACG
TCGACACCTATTGTTCCTTCAACTCGCAACTCGCTCAGATCATCAACATTCAAGGGAAGACGCAACTGGG
CCTTCCGCTTGAGGGTTGCAGTGGCCTGACTCCGGACCAGATCAGCAAGATCGATTTCAAGAAGATTGAC
TTCAGTGCATTCTCGAGCCAGATGATGGATCAAGCTATGAAAGGCCTCCCGAAAAATATCACCGGGAATT
ACACACCGATCATGCAGAACACTCCGAGCGGATCTTCCCAAAAGGGCGGCTCTGCCGTTCTTCCGACTTA
CTGA