SecReT4
Protein ID: 194447186
T4SS name [ID]Tra_I [170]
Gene symbol-
Locus tagSeHA_A0091
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. SL476
Repliconplasmid pSL476_91 [GenBank: NC_011081] [Browse all T4SS(s) in this replicon]
Location [Strand]58540..58944 [-]
ProductTraR
Component typeTraR_I
UniProt IDB4T7G3
KEGG IDseh:SeHA_A0091
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 134 a.a.     [Download]
>gi|194447186|ref|YP_002043926.1| TraR [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476]
MSRIRVVAARLYAAFIHAQLFVMSCRSKLTKFLLLIPMMLLPKAVLADGDLADMVRNVEQGAKTAQSSSL
TIAQFIGVIAFLGGLIGLKKVGKQGGMGLAGCILSIVIGALLAAGPEMMSRSQKQLGISTISIG
 
Nucleotide Sequence: 405 bp     [Download]
>gi|194447175|ref|NC_011081.1|:c58944-58540 Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 plasmid pSL476_91, complete sequence
ATGTCACGTATTCGTGTCGTAGCGGCCCGTCTGTACGCCGCATTTATCCACGCACAACTGTTTGTAATGT
CATGCCGGAGCAAACTGACTAAGTTCCTGCTGCTCATTCCCATGATGTTGCTGCCCAAAGCCGTTCTTGC
CGATGGAGATCTTGCCGATATGGTTCGCAATGTCGAACAAGGTGCCAAAACAGCACAGTCATCATCACTG
ACTATTGCGCAGTTCATCGGCGTAATTGCGTTTCTCGGGGGCCTGATTGGGCTGAAAAAAGTTGGGAAAC
AAGGGGGGATGGGACTGGCTGGTTGCATTCTATCTATCGTCATTGGGGCGCTACTTGCCGCCGGACCTGA
AATGATGAGTCGCAGCCAGAAACAGCTGGGGATTTCCACAATTTCCATTGGCTAA