SecReT4
Protein ID: 194447213
T4SS name [ID]Tra_I [170]
Gene symbol-
Locus tagSeHA_A0092
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. SL476
Repliconplasmid pSL476_91 [GenBank: NC_011081] [Browse all T4SS(s) in this replicon]
Location [Strand]58995..59522 [-]
ProductTraQ
Component typeTraQ_I
UniProt IDB4T7G4
KEGG IDseh:SeHA_A0092
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 175 a.a.     [Download]
>gi|194447213|ref|YP_002043927.1| TraQ [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476]
MNMDALTAIENFASSIFSAGMDFLFTWGEFIGVISMITLFARARSAGPVKMSPGKFIAGMLTSCMLVSLP
AMINAGGVQMGFRADSFGPIAYVQPQTFGAAAGAANAVLSLAKLAGVGFVMNGISIWRKAGLDGHTALSA
SESVSKGNVKFIAGVLLVFIDRVLNALLASIGIVF
 
Nucleotide Sequence: 528 bp     [Download]
>gi|194447175|ref|NC_011081.1|:c59522-58995 Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 plasmid pSL476_91, complete sequence
ATGAACATGGATGCCCTGACCGCCATTGAGAACTTTGCCAGCAGTATTTTCAGTGCCGGAATGGATTTCC
TGTTTACCTGGGGAGAATTCATCGGGGTGATCAGCATGATTACCCTGTTTGCCCGCGCCCGTTCAGCCGG
TCCGGTAAAAATGTCTCCCGGAAAATTTATTGCGGGGATGTTAACCAGCTGCATGCTCGTATCACTCCCG
GCAATGATTAACGCCGGAGGCGTACAAATGGGATTCAGGGCTGACTCATTTGGCCCGATTGCATATGTGC
AACCTCAGACGTTTGGCGCTGCTGCTGGCGCAGCAAATGCAGTTCTGTCGCTGGCCAAGCTGGCCGGTGT
GGGATTTGTCATGAACGGGATATCCATCTGGCGCAAGGCCGGACTCGATGGACATACCGCACTGAGTGCC
AGTGAATCCGTCAGTAAGGGAAACGTCAAATTTATTGCCGGCGTCCTGCTGGTCTTTATCGATCGTGTCC
TCAATGCCCTGCTGGCAAGCATTGGAATCGTCTTCTGA