SecReT4
Protein ID: 194447244
T4SS name [ID]Tra_I [170]
Gene symbol-
Locus tagSeHA_A0077
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. SL476
Repliconplasmid pSL476_91 [GenBank: NC_011081] [Browse all T4SS(s) in this replicon]
Location [Strand]45493..46701 [-]
Productconjugal transfer protein
Component typeTrbA_I
UniProt IDB4T7E9
KEGG IDseh:SeHA_A0077
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 402 a.a.     [Download]
>gi|194447244|ref|YP_002043912.1| conjugal transfer protein [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476]
MSYNRQPVAEDPMQIWGAVGVLLILLLFVIWLFLPEVVYASCLILHTLWGLVDWGPFHNYAAPRYNLLAM
TGNNAANISYSQWVNVMEQTIGILWMYLLPVTLWCLWEWYQHPGQSRFTRRPVDITRLPHIFASLSPAIA
PVLADGDPEKLFHGGKRPERRVALTPEAFVEQHTLITNMQLDVAAARRCFMAQLGKPLTSWKDMAPHEKA
LFAIFGLQYFLDDRKAALKLMDTLNLSCRIKSKRDSGKFCTPVYSLAKSAFQRVIKSNGAQQWLKQHRYV
RSGLVWLYAHDLRLTPPNWIWLKGVDRTLFYALHRANTTKGFIEGAGVVAVARAEAEAMRFGLPCPEPCV
DEAVEGLRRDMLSLGLIWDEPQPDRDRKRRILTNWSLTDDILPRTPATDNEF
 
Nucleotide Sequence: 1209 bp     [Download]
>gi|194447175|ref|NC_011081.1|:c46701-45493 Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 plasmid pSL476_91, complete sequence
ATGTCTTACAATCGACAGCCTGTCGCAGAAGATCCTATGCAGATATGGGGCGCTGTTGGTGTCCTTCTTA
TCCTGCTGCTATTCGTCATATGGTTATTCTTGCCGGAAGTGGTTTACGCCAGCTGCCTGATTCTTCATAC
CTTATGGGGACTGGTCGACTGGGGACCATTTCATAACTATGCAGCACCACGATACAACCTGCTTGCCATG
ACCGGTAACAACGCCGCCAACATAAGCTATAGCCAGTGGGTTAACGTCATGGAACAGACCATAGGTATTC
TGTGGATGTACCTCTTACCTGTGACACTCTGGTGTTTGTGGGAGTGGTATCAACATCCGGGACAAAGCCG
TTTCACCCGCAGACCAGTAGATATTACCCGACTGCCACACATCTTTGCTTCGTTATCCCCTGCTATCGCC
CCTGTACTGGCAGATGGTGATCCGGAAAAACTCTTTCATGGTGGTAAACGACCTGAACGGCGGGTTGCTC
TCACCCCGGAAGCATTTGTCGAACAGCATACTCTCATCACCAATATGCAGCTCGATGTTGCAGCTGCAAG
ACGATGTTTCATGGCCCAGTTGGGTAAACCTTTAACGTCCTGGAAAGACATGGCACCACATGAAAAAGCG
CTCTTTGCCATATTTGGCCTTCAGTATTTCCTGGATGATCGTAAGGCAGCATTAAAGCTCATGGATACAC
TGAACCTCTCATGCAGAATTAAAAGCAAACGGGACAGCGGGAAATTCTGTACCCCTGTTTATTCACTGGC
CAAATCAGCTTTCCAGAGAGTGATTAAAAGCAACGGAGCACAGCAATGGCTGAAACAACATCGCTACGTC
CGCAGTGGGCTGGTCTGGCTGTATGCACATGACCTGCGGCTTACGCCACCCAACTGGATTTGGCTGAAAG
GCGTGGACAGGACGCTGTTTTATGCATTACACCGCGCCAATACCACGAAAGGATTTATTGAAGGCGCTGG
CGTGGTGGCCGTTGCACGTGCAGAGGCCGAAGCCATGCGTTTTGGTCTTCCCTGCCCTGAACCCTGTGTT
GATGAAGCGGTGGAAGGCTTACGGCGGGATATGCTCAGTCTCGGTCTTATCTGGGATGAACCACAACCAG
ATCGCGACCGGAAACGCCGCATCCTGACCAACTGGTCCCTCACCGACGACATCCTGCCCCGCACACCTGC
TACAGACAACGAATTCTGA