SecReT4
Protein ID: 194447277
T4SS name [ID]Tra_I [170]
Gene symbol-
Locus tagSeHA_A0084
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. SL476
Repliconplasmid pSL476_91 [GenBank: NC_011081] [Browse all T4SS(s) in this replicon]
Location [Strand]49709..51877 [-]
Productintegral membrane protein
Component typeTraY_I
UniProt IDB4T7F6
KEGG IDseh:SeHA_A0084
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 722 a.a.     [Download]
>gi|194447277|ref|YP_002043919.1| integral membrane protein [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476]
MKILLRALCAGLAISSLPAMASVTYQDIVSAATNPDDLSRQALVTIFGDVVTNPLSTSAPTLIGSMFGAF
NSIIAVLAVVWFMFIGIRHVVRSGHQGQVFSTGRDIVGTLSVVAGFLMIVPTGNGWSIAQLIMLWGASIM
GVGSANVMVQLAADNIANGYSMTVQPVQASTRTAARGIFEMELCKYAVNAGLNDFNQTAKSSTSLMTESA
KTASGNYTVTVSNGSGICGSASLSVEGNGTTDQSTIGKFFNPFSKNEYSGVISAQRAAMDNMISDMDNAA
SEFVTTFLEKRNSGNGTLPDIETRIQKVADEYERAVQKSLPTDNGEQSRKEALKSYLTTYGWVTLGAWYQ
TFATANQRLAELADRAPAVTSMSSLGEVGDTDLFSAVMSAYRTQLQNSSYTPPLGTVVSSSEQRMANAQD
PKSALSEIMGPLVSLTNRIATETSGTGTTSAQINPLIKMKNIGDITMVSAEGIWTIYTTARVVVAGGKDS
ILVKFFNSLTGAASMLTALFEALAPPVYFLLFLMFCAGFSLSIYLPFIPFIFWMTGIGNWIVSVLIGCTA
GPLWAATHLGTSEDRGSRAAYGYIYLIDSMIRPPIMVFGFFFASVAIIAVGTILNALFGAALVNVQFNSL
TGIFSLAGFLLIYARICTTTVAAIFALQAYLPDHVINFLGGRDGANTLGSMANSVKEIFIGGSRNIRHTP
GMKTDRLKDNTKGSDDKDGIKG
 
Nucleotide Sequence: 2169 bp     [Download]
>gi|194447175|ref|NC_011081.1|:c51877-49709 Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 plasmid pSL476_91, complete sequence
GTGAAAATTTTACTTCGCGCACTCTGTGCAGGCCTTGCTATATCCTCACTGCCGGCAATGGCTTCAGTGA
CCTATCAGGATATTGTGTCTGCCGCCACCAATCCTGACGATCTGTCCCGCCAGGCGCTGGTCACGATATT
CGGTGATGTAGTCACCAATCCACTGTCAACCAGCGCCCCCACTCTGATCGGAAGCATGTTCGGGGCGTTC
AACAGTATCATCGCCGTACTTGCCGTTGTCTGGTTTATGTTCATTGGTATCCGTCATGTTGTGCGTTCGG
GGCATCAGGGACAGGTATTCAGCACCGGACGCGATATCGTCGGCACACTGAGTGTCGTTGCAGGTTTTCT
GATGATCGTTCCAACCGGAAATGGCTGGAGTATCGCTCAGCTCATTATGTTATGGGGCGCATCGATAATG
GGGGTTGGGTCCGCCAATGTGATGGTGCAACTTGCCGCTGATAATATCGCAAATGGTTATTCAATGACTG
TACAGCCAGTTCAGGCATCCACACGAACAGCAGCGCGTGGCATTTTTGAAATGGAACTGTGTAAGTATGC
GGTTAACGCAGGACTAAATGATTTTAATCAGACGGCCAAATCCTCGACTTCACTGATGACAGAATCAGCT
AAAACCGCCAGTGGTAATTACACTGTCACGGTATCCAATGGCAGCGGTATCTGTGGTTCAGCCAGCCTGT
CAGTAGAAGGAAACGGAACAACAGATCAATCGACGATTGGAAAATTCTTTAATCCCTTCAGTAAAAACGA
ATACAGCGGTGTTATCTCAGCACAACGTGCAGCCATGGATAATATGATTAGCGACATGGACAACGCTGCC
AGTGAGTTTGTGACAACATTTCTGGAAAAAAGAAATTCTGGCAACGGAACACTGCCGGATATCGAGACAC
GAATTCAGAAAGTAGCCGACGAATACGAACGTGCTGTGCAAAAATCGCTACCCACTGATAACGGAGAGCA
ATCCAGAAAAGAGGCTCTTAAATCTTATCTCACAACCTACGGGTGGGTAACGCTTGGCGCATGGTATCAG
ACCTTTGCCACTGCTAACCAGCGTCTGGCAGAGCTGGCTGACAGAGCTCCAGCTGTAACTTCAATGTCAT
CACTGGGAGAAGTTGGTGATACTGACTTATTCAGTGCGGTCATGAGTGCCTATAGGACGCAACTGCAGAA
TTCCTCCTATACGCCACCGCTGGGCACAGTAGTATCATCCAGTGAACAACGCATGGCAAATGCACAAGAT
CCGAAATCTGCCTTGTCTGAAATTATGGGCCCCCTTGTTAGTCTCACTAACAGGATTGCAACGGAAACAA
GTGGCACAGGCACAACCAGTGCTCAAATTAATCCTCTGATAAAAATGAAAAATATCGGAGATATAACAAT
GGTAAGTGCAGAAGGAATCTGGACTATATATACAACGGCCAGAGTTGTCGTTGCCGGTGGCAAAGATTCA
ATTCTTGTAAAATTCTTTAACTCACTAACAGGTGCCGCTTCGATGCTTACCGCGCTGTTTGAAGCACTTG
CACCACCTGTTTATTTTCTTTTGTTCCTGATGTTCTGTGCTGGATTTTCCTTATCAATTTACCTGCCATT
CATTCCGTTTATTTTCTGGATGACAGGCATCGGGAACTGGATAGTCAGCGTATTAATAGGATGTACCGCC
GGGCCGCTGTGGGCTGCAACACATCTCGGGACATCAGAAGACAGAGGAAGTCGGGCAGCCTACGGTTATA
TATACTTAATTGATAGTATGATAAGGCCGCCCATCATGGTCTTTGGTTTTTTCTTTGCTTCTGTAGCCAT
CATCGCCGTAGGCACAATACTGAATGCATTATTTGGCGCTGCCCTGGTTAACGTACAGTTCAATTCGCTG
ACCGGTATTTTCAGTCTTGCTGGTTTCTTGCTGATATACGCCAGAATTTGTACAACCACTGTAGCTGCCA
TATTTGCCCTTCAGGCCTACCTACCTGATCATGTTATTAACTTCCTAGGGGGACGTGATGGAGCCAACAC
GCTTGGCAGCATGGCAAATTCTGTTAAAGAAATATTTATTGGAGGAAGTCGCAATATCCGACATACTCCT
GGAATGAAAACAGATCGTCTTAAAGATAATACAAAAGGAAGTGACGACAAGGACGGAATAAAAGGATAA