SecReT4
Protein ID: 197286311
T4SS name [ID]Tra_F [584]
Gene symbol-
Locus tagPMI2465
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T4SS(s) in this replicon]
Location [Strand]2694408..2694794 [-]
Productplasmid-like protein
Component typeTraA_F
UniProt IDB4EWT2
KEGG IDpmr:PMI2465
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 7.7e-06, Aligned region: 7..92
Protein Sequence: 128 a.a.     [Download]
>gi|197286311|ref|YP_002152183.1| plasmid-like protein [Proteus mirabilis HI4320]
MTNAVRTIQTQRLMTIGALGLMALMISEPSFAGTGGDAFTDVWDTLKDWTQGTLGRIVAGAMVLVGIVGG
IARQSLMAFALGIGGGMGLYNTPTVVESVMSATLPVVASTQEVIGTTVPAISAVLLGT
 
Nucleotide Sequence: 387 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c2694794-2694408 Proteus mirabilis HI4320 chromosome, complete genome
ATGACAAATGCAGTTCGCACCATTCAAACTCAGCGCCTAATGACCATTGGTGCGCTTGGTTTAATGGCGT
TAATGATTTCGGAGCCCTCATTTGCGGGCACCGGTGGTGATGCTTTCACCGATGTGTGGGATACCCTAAA
AGACTGGACCCAAGGTACTTTGGGACGGATCGTAGCGGGAGCCATGGTACTGGTGGGTATTGTGGGCGGT
ATCGCTCGCCAAAGCTTGATGGCTTTTGCCTTGGGCATTGGTGGCGGTATGGGTCTCTACAATACGCCAA
CAGTCGTTGAAAGTGTTATGTCTGCAACTTTACCTGTTGTTGCCAGCACTCAAGAAGTCATTGGCACAAC
AGTTCCAGCAATCAGCGCCGTCTTACTGGGCACCTGA