SecReT4
Protein ID: 197286417
T4SS name [ID]Tfc [686]
Gene symbol-
Locus tagPMI2570
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T4SS(s) in this replicon]
Location [Strand]2807168..2808679 [-]
Producthypothetical protein
Component typeTfc19
UniProt IDB4EXG9
KEGG IDpmr:PMI2570
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 2.3e-114, Aligned region: 7..486
Protein Sequence: 503 a.a.     [Download]
>gi|197286417|ref|YP_002152289.1| hypothetical protein PMI2570 [Proteus mirabilis HI4320]
MTNSYLEYFLTLLAWVVNNGLWSVLTSTGLFALPLVFKVLGIWLKVREEGEDEGNKGSLAIVRIENALYG
AFVVILFCCVPLMEVSVSTLQFDTSRTKTCGTWTPVKPAESGYSGVVSSLDNQTAKIPLWWMLVHKLSKG
VTQAAVASIPCRPDLRQVRFEVQHSNIKNPALAAALQDFTDDCYSRALYDWKAKDQGKTQDEKTLQDITW
IGSATFMKGEYHQIQSRTPRAGFPWDADRDDGYANVNGNGYPTCYQWWNDANAGLLKLVKEQTDEGMWLR
ARAAMKLINKNSKEFEEAIVRRLVSPANLDVSGGRVYRGYGGNADMTVMNELARMGGVAGTSLASLGAFP
AFDTMRQSLPMVQGLMLMAVYIMIPMVLMFSAYEFKTAITVTFVIFALNFLTFWWELARWIDSWMMEALY
NSDTHSQWNMNGLQNTSDDVIMNLVMGTMFLVLPALWLTAFGWAGAKVGSELGNMTSNATSPAHSAGGKG
GQLAEQAISKKVN
 
Nucleotide Sequence: 1512 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c2808679-2807168 Proteus mirabilis HI4320 chromosome, complete genome
ATGACAAACAGTTATCTCGAGTATTTTCTCACGCTGCTGGCCTGGGTGGTGAATAACGGATTGTGGTCGG
TACTGACCAGCACCGGGCTGTTTGCGCTGCCGCTGGTCTTTAAAGTGCTGGGGATCTGGCTGAAAGTGCG
GGAAGAGGGGGAGGATGAGGGTAACAAAGGTTCACTGGCAATTGTGCGTATCGAGAACGCGCTTTACGGC
GCCTTTGTGGTGATCCTGTTTTGTTGTGTGCCGTTGATGGAGGTGAGTGTCAGTACCCTGCAATTTGATA
CCAGCCGGACCAAAACCTGCGGCACCTGGACCCCGGTGAAGCCGGCGGAATCCGGTTACAGCGGCGTGGT
GTCGTCACTGGATAATCAGACAGCCAAAATCCCGCTGTGGTGGATGCTGGTACATAAGCTGTCGAAAGGG
GTGACTCAGGCGGCGGTGGCCAGCATTCCGTGCCGGCCGGATTTGCGTCAGGTGCGTTTTGAGGTGCAGC
ACAGCAACATTAAAAATCCGGCGCTGGCTGCCGCACTTCAGGATTTTACGGATGACTGTTACTCACGTGC
CCTGTATGACTGGAAAGCGAAAGATCAGGGAAAAACACAGGATGAAAAAACGTTACAGGATATCACCTGG
ATAGGCTCGGCCACCTTTATGAAAGGGGAATATCATCAGATCCAGTCACGGACACCGCGGGCGGGCTTTC
CCTGGGATGCCGACCGGGATGACGGGTATGCGAATGTCAACGGCAACGGTTACCCGACCTGTTATCAGTG
GTGGAATGATGCGAATGCAGGGTTACTGAAACTTGTCAAAGAGCAGACCGATGAAGGGATGTGGCTGCGT
GCCCGGGCGGCGATGAAGCTGATTAATAAAAACTCGAAAGAGTTTGAGGAGGCCATCGTCCGCCGGCTGG
TGAGTCCGGCGAATCTGGATGTCTCCGGCGGCCGGGTATACCGGGGATACGGGGGTAATGCGGATATGAC
GGTGATGAATGAGCTGGCCAGAATGGGAGGGGTAGCCGGGACTTCGCTGGCGTCACTGGGGGCATTCCCT
GCCTTTGATACGATGCGACAGTCCTTACCGATGGTGCAGGGGCTGATGTTAATGGCGGTGTATATCATGA
TCCCGATGGTGCTGATGTTTTCGGCGTATGAATTTAAGACGGCGATAACGGTGACGTTTGTGATATTTGC
GCTGAACTTTCTGACATTCTGGTGGGAGCTGGCACGCTGGATAGACAGCTGGATGATGGAGGCACTGTAT
AATTCCGATACGCACAGTCAGTGGAATATGAACGGGCTTCAGAACACGTCTGATGATGTCATTATGAACC
TGGTAATGGGAACGATGTTTTTGGTGTTGCCGGCGTTGTGGTTGACAGCATTTGGTTGGGCTGGAGCTAA
AGTTGGGTCCGAGCTAGGTAATATGACATCTAACGCGACTTCACCTGCGCATAGTGCGGGGGGGAAAGGA
GGACAGTTAGCAGAACAAGCTATTTCTAAAAAAGTTAACTAA