SecReT4
Protein ID: 197286420
T4SS name [ID]Tfc [686]
Gene symbol-
Locus tagPMI2573
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T4SS(s) in this replicon]
Location [Strand]2810475..2811449 [-]
Producthypothetical protein
Component typeTfc23
UniProt IDB4EXH2
KEGG IDpmr:PMI2573
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 2e-87, Aligned region: 32..313
Protein Sequence: 324 a.a.     [Download]
>gi|197286420|ref|YP_002152292.1| hypothetical protein PMI2573 [Proteus mirabilis HI4320]
MTRQSHRRRLAGALLLGCSLVPVAEASLSTATLVASAASPSCISWRISGICYWLKCGWGGCRIRTSVRVS
HFIPQAVVSAYHAPGENPWREMSLVSGAAGGIENAVTGVLSGVSAGGGNSEQKFEAKRKTALHFFYADAI
GHPATTLIGGSIPGYSCDSAATPLFPYYLSTLDSVPWRLGVPEMAYPEAIIPGKREIGGQSRGNMWGNLY
PRSGFVNQQDGDKAAAVVAQRVADIMTRTGQAHTYVPLKGNRRDGYWPPDAVTENTGTKNHKWQRLSPGL
KNSCAVFPDEGGAQAQDGNYAWALWQPYSCCKRMGQKFLYSTTF
 
Nucleotide Sequence: 975 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c2811449-2810475 Proteus mirabilis HI4320 chromosome, complete genome
ATGACCCGACAATCACATCGCCGGCGTCTGGCGGGGGCTTTGTTACTCGGTTGTTCACTGGTGCCGGTGG
CGGAAGCCAGTCTGAGTACCGCCACTCTGGTCGCTTCTGCGGCCTCACCGTCGTGTATCAGCTGGCGTAT
CAGCGGGATTTGCTACTGGCTGAAGTGTGGCTGGGGCGGCTGCCGTATCCGGACATCTGTCCGGGTGTCA
CATTTTATTCCGCAGGCGGTGGTCTCGGCCTACCATGCCCCGGGTGAAAACCCGTGGCGGGAAATGTCAC
TGGTCAGCGGGGCGGCCGGCGGGATTGAAAATGCCGTGACCGGCGTGCTGAGCGGGGTATCTGCCGGGGG
CGGAAACAGTGAACAGAAGTTTGAGGCAAAACGTAAAACCGCCCTGCACTTTTTTTATGCGGATGCTATC
GGTCATCCGGCAACCACCCTTATCGGCGGCAGTATTCCGGGGTATTCCTGTGACAGCGCAGCCACACCGC
TGTTTCCTTATTACCTGAGCACGCTCGACAGTGTGCCGTGGCGGCTCGGTGTGCCGGAAATGGCGTATCC
GGAAGCGATAATTCCCGGGAAACGGGAAATCGGGGGGCAGAGCCGGGGCAACATGTGGGGAAATCTCTAT
CCGCGCAGCGGTTTTGTCAACCAGCAGGACGGGGATAAAGCGGCGGCTGTGGTGGCGCAGCGCGTGGCAG
ATATTATGACCCGCACCGGGCAGGCGCATACCTATGTGCCCCTGAAAGGCAACCGCCGGGATGGCTATTG
GCCGCCGGACGCGGTGACGGAGAATACCGGGACAAAAAACCATAAATGGCAGCGCCTGTCGCCGGGGCTG
AAAAACAGCTGTGCGGTGTTTCCGGATGAGGGCGGAGCACAGGCACAGGACGGTAATTATGCCTGGGCAT
TGTGGCAGCCGTACAGCTGCTGCAAGCGCATGGGGCAAAAATTTCTGTACAGCACAACGTTTTAA