SecReT4
Protein ID: 197286421
T4SS name [ID]Tfc [686]
Gene symbol-
Locus tagPMI2574
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T4SS(s) in this replicon]
Location [Strand]2811446..2811886 [-]
Productlipoprotein
Component typeTfc24
UniProt IDB4EXH3
KEGG IDpmr:PMI2574
PDB IDNA
Domain hit(s) vs Pfam DUF1525 [PF07511], Evalue: 2.3e-28, Aligned region: 26..139
Protein Sequence: 146 a.a.     [Download]
>gi|197286421|ref|YP_002152293.1| lipoprotein [Proteus mirabilis HI4320]
MKKRFLSLSGLLMLSLSCLPLTAGAAVVLYTTQDDALPQTDIPFEVVYLDAPERLLDEALLQPGTELSEA
DAPHITALLQSPAWQARETALRQAYQGVVQAWQLGVSSLPAVVVDAQWVVYGTTDIAQAVTQIQQYREQQ
EGGGQP
 
Nucleotide Sequence: 441 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c2811886-2811446 Proteus mirabilis HI4320 chromosome, complete genome
ATGAAAAAACGATTTTTATCTCTTTCCGGATTGCTGATGCTGTCGCTGTCATGCCTGCCGTTGACCGCCG
GGGCGGCAGTGGTGCTGTATACCACGCAGGATGACGCTCTGCCGCAGACGGACATCCCGTTTGAGGTGGT
GTATCTGGATGCGCCTGAACGCCTGCTGGATGAGGCCCTGCTTCAGCCGGGGACGGAACTGAGTGAAGCG
GATGCCCCGCACATCACCGCCCTGTTACAAAGTCCGGCCTGGCAGGCCAGAGAAACGGCATTACGGCAGG
CTTATCAGGGCGTGGTTCAGGCCTGGCAGCTGGGGGTGTCATCTCTGCCGGCGGTCGTCGTTGATGCGCA
GTGGGTGGTTTACGGCACCACCGATATTGCACAGGCGGTGACGCAGATACAGCAGTACCGGGAACAACAG
GAAGGAGGAGGTCAACCATGA