SecReT4
Protein ID: 197286423
T4SS name [ID]Tfc [686]
Gene symbol-
Locus tagPMI2576
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T4SS(s) in this replicon]
Location [Strand]2814285..2817152 [-]
Producthypothetical protein
Component typeTfc16
UniProt IDB4EXH5
KEGG IDpmr:PMI2576
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 8.7e-64, Aligned region: 63..331
AAA_10 [PF12846], Evalue: 6.3e-44, Aligned region: 526..869
Protein Sequence: 955 a.a.     [Download]
>gi|197286423|ref|YP_002152295.1| hypothetical protein PMI2576 [Proteus mirabilis HI4320]
MGFSLFRSRRKAQAVSAEKTDENKADKTVHRSTPAENAGLGRQPLSRPGKMTRADEQKIYHANPSFIDYL
PWVEFLDEEQCLLLDDGVSVGAVYAVEPAPTEGRSAGRLLEIRDAVEDALQDSLDEHDDNPWVVQFFCQD
EDDVSVTLATLRDYILPAARGTAFTEAWLTEMARHLRGIARPEGLFKDTEVTGQPWRGQQRRTRMVVYRR
LGNSYTDPMPPVAMLNQMCDRLVSSLGSAGVQCVRQDGRQVHQWLLRHFNPAPDWVDRETLYREGAYWPA
AEEAPGTLPVLKDFAETLWFTPPRSDVENGVWWFDNLAHGVVNIEKLRKAPGPGHLTGEQKRGDKNINAL
MDLFPEGTMLSMTIVTQPQDTLEQEFTRLGKNSVGENTDSQRTRRDVETARGLLGHRHKLYRASLSLLLR
AGSVEELNKKRVDLTATLLNAGLEPVKPEYDVAPLNGYLRALPMCFDPQTDKKHWYTRLTWVQHLAGLLP
VTGRTSGTGHPGWSFFNRGGGVLTFDPQNKQDRTQNAHLLLFGPTGAGKSATLCAQLSQLMAVRRPRLFI
AEAGNSFGLLADYYASLGLSVNKVSVKPGSGVRLPLFADAHQLLMMDEQRLALNADELPETDSESEDDDG
QRDILGEMEISARMMITGGDVREEAELKRADRAMIRRALMAGARASYAADRQMLPADLQEALYALSRGEG
EEEGRALNPQRRAKAAEMAESLGMFTEPGSFEHELFNLPGELWPEADVTLIDLGHLAREGYEAQMALTMV
SLINSINNIAERDQYRARDINFVVDEAHIVTVNPLLSPYVTKVVKMWRKLGAWLWLATQNLDDYPDCAEK
MLNMAEWWVCLTMPQKEVEAIARFKTLSEEQKQVLLSAAKLSGCYTEGVVLARKVEALFRVVQPSLYLAL
GMTEKEEKQQRRVLMEQYGCSELEAAFRVADELDRKRGLPPRVPG
 
Nucleotide Sequence: 2868 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c2817152-2814285 Proteus mirabilis HI4320 chromosome, complete genome
ATGGGATTTTCATTATTCCGCTCACGCCGGAAAGCGCAGGCGGTTTCTGCTGAAAAAACGGATGAAAACA
AGGCTGACAAAACCGTACACCGCAGTACACCGGCAGAGAATGCCGGTTTAGGCCGTCAGCCGCTTTCCCG
GCCGGGAAAAATGACCCGGGCGGATGAGCAGAAGATTTACCATGCGAATCCGTCCTTTATTGATTACCTG
CCCTGGGTGGAATTTCTGGATGAGGAGCAATGCCTGCTGCTTGATGACGGGGTGTCGGTCGGGGCGGTGT
ATGCCGTTGAGCCGGCGCCGACGGAAGGGCGCTCTGCCGGCCGTCTGCTCGAAATCCGGGATGCGGTGGA
GGATGCGCTTCAGGACAGTCTGGATGAGCATGATGATAACCCGTGGGTGGTGCAGTTTTTTTGTCAGGAT
GAGGACGACGTGAGCGTCACACTGGCCACATTGCGGGACTATATCCTGCCGGCGGCCCGGGGCACCGCGT
TTACCGAAGCCTGGCTGACCGAAATGGCGCGTCATTTACGGGGGATTGCCCGTCCGGAAGGGCTGTTTAA
GGACACGGAGGTGACCGGACAACCCTGGCGCGGACAGCAGCGCCGGACCCGGATGGTGGTTTACCGCCGG
CTGGGGAACAGCTATACCGATCCGATGCCGCCGGTGGCGATGCTCAATCAGATGTGTGACCGGCTGGTCA
GCAGTCTGGGCAGTGCCGGCGTGCAGTGTGTCCGCCAGGACGGGAGGCAGGTGCATCAGTGGCTGCTGCG
TCATTTCAATCCGGCCCCTGACTGGGTGGACCGGGAGACGCTGTACCGGGAAGGGGCGTACTGGCCGGCG
GCGGAGGAAGCCCCGGGCACCCTGCCGGTGCTGAAGGATTTTGCGGAAACGCTGTGGTTTACCCCGCCCC
GGTCGGATGTGGAAAACGGCGTGTGGTGGTTTGATAACCTGGCGCACGGTGTGGTGAATATCGAAAAACT
GCGTAAAGCCCCGGGGCCGGGGCACCTGACCGGGGAGCAGAAGCGCGGTGACAAAAATATCAATGCGCTG
ATGGACCTGTTTCCGGAAGGGACGATGCTGTCGATGACCATCGTCACACAGCCTCAGGATACGCTGGAGC
AGGAATTTACCCGGCTGGGGAAAAACTCGGTGGGGGAAAACACCGACTCGCAACGTACCCGCCGGGACGT
GGAAACCGCCAGAGGTTTACTGGGGCACCGCCATAAGCTTTACCGGGCCTCCCTGTCATTGCTGCTGCGT
GCCGGCTCGGTGGAGGAACTGAACAAAAAGCGCGTGGATCTGACGGCCACGCTGCTGAATGCCGGTCTGG
AGCCGGTGAAGCCGGAATATGATGTGGCGCCGCTGAACGGGTATCTGCGTGCCCTGCCGATGTGTTTTGA
CCCGCAGACGGATAAAAAACACTGGTATACCCGGCTGACCTGGGTACAGCACCTGGCCGGATTACTGCCG
GTGACCGGGCGCACCAGCGGCACCGGGCATCCCGGCTGGAGTTTCTTTAACCGGGGCGGCGGGGTGCTGA
CCTTTGATCCGCAGAATAAACAGGATCGTACCCAGAATGCGCATCTGCTGTTATTCGGTCCCACCGGGGC
CGGTAAATCCGCCACCTTATGCGCACAGTTATCGCAGCTGATGGCGGTCCGCCGTCCGCGTCTGTTTATT
GCGGAGGCCGGTAACTCCTTTGGTTTACTGGCGGACTATTACGCCAGTCTGGGGCTGAGTGTCAATAAGG
TCAGTGTCAAGCCCGGCAGCGGGGTGCGTCTGCCGCTGTTTGCGGATGCGCATCAGCTGCTGATGATGGA
TGAACAGCGTCTGGCACTGAATGCGGATGAACTGCCAGAGACGGACAGTGAATCTGAGGATGATGACGGG
CAGCGTGACATTCTGGGGGAAATGGAAATCTCCGCCCGCATGATGATCACCGGCGGGGATGTGCGGGAAG
AAGCGGAGCTGAAGCGGGCTGACCGGGCGATGATCCGCCGGGCGCTGATGGCGGGGGCCCGGGCGTCTTA
TGCCGCCGACCGGCAGATGCTGCCGGCGGATTTGCAGGAGGCGCTGTATGCCCTCTCCCGGGGGGAAGGT
GAAGAGGAAGGGCGGGCATTAAATCCGCAGCGCCGGGCGAAAGCGGCCGAAATGGCGGAATCCCTGGGGA
TGTTTACCGAACCGGGCAGTTTTGAGCATGAGCTGTTTAATCTGCCGGGGGAGCTGTGGCCGGAGGCGGA
TGTGACCCTGATTGATTTGGGGCACCTGGCGCGGGAAGGGTATGAGGCCCAGATGGCGCTGACGATGGTG
AGTCTTATCAACTCCATCAACAATATTGCCGAGCGGGATCAGTACCGGGCCCGGGACATTAATTTTGTGG
TGGATGAGGCGCATATCGTGACGGTCAACCCGCTGTTATCCCCCTATGTGACCAAAGTGGTGAAAATGTG
GCGGAAACTGGGGGCCTGGCTGTGGCTGGCGACCCAGAACCTCGATGACTATCCGGACTGTGCCGAGAAA
ATGCTCAATATGGCGGAGTGGTGGGTGTGTCTGACGATGCCGCAGAAAGAGGTGGAGGCAATCGCCCGCT
TTAAGACGCTCAGTGAGGAGCAGAAACAGGTGCTGCTGTCCGCAGCCAAACTCTCCGGCTGTTACACGGA
AGGGGTGGTGCTGGCGCGGAAAGTGGAGGCGCTGTTCCGGGTGGTACAGCCGAGCTTATATCTGGCGCTG
GGGATGACGGAAAAAGAGGAGAAGCAGCAACGGCGGGTGCTGATGGAGCAATACGGATGCAGTGAGCTGG
AAGCGGCGTTCAGGGTGGCAGATGAACTTGACCGGAAACGGGGGTTACCGCCCCGGGTGCCGGGATGA