SecReT4
Protein ID: 197286424
T4SS name [ID]Tfc [686]
Gene symbol-
Locus tagPMI2577
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T4SS(s) in this replicon]
Location [Strand]2817152..2817589 [-]
Productlipoprotein
Component typeTfc15
UniProt IDB4EXH6
KEGG IDpmr:PMI2577
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 145 a.a.     [Download]
>gi|197286424|ref|YP_002152296.1| lipoprotein [Proteus mirabilis HI4320]
MRMMKCVMKSRVLCALVLLLAGCATSKEELLPAGNSDMMAIWSGRQADPNGAADSRTVTETARSALRRAL
TNDEAARLQQADTAYTRTQSSEIHQQFPRLPNPDMVMYVFPHLSAGNLPVPGYSTVFPFYHQVQYALPGE
RVEGL
 
Nucleotide Sequence: 438 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c2817589-2817152 Proteus mirabilis HI4320 chromosome, complete genome
ATGAGAATGATGAAATGTGTGATGAAAAGCAGAGTGCTGTGCGCACTGGTGTTGTTGCTGGCCGGCTGTG
CCACCTCCAAAGAGGAGCTGCTGCCGGCGGGAAACAGCGACATGATGGCCATCTGGTCCGGCAGACAGGC
TGATCCGAACGGTGCGGCGGACAGCCGGACGGTGACGGAGACCGCCCGCAGCGCCCTGCGACGCGCCCTG
ACGAATGATGAAGCCGCGCGCCTTCAGCAGGCGGACACCGCGTATACCCGGACACAAAGCAGTGAGATCC
ATCAGCAGTTTCCGCGTCTGCCGAACCCGGACATGGTGATGTATGTGTTCCCGCATCTCTCGGCCGGCAA
TCTGCCGGTGCCGGGATACAGTACGGTGTTTCCGTTTTACCATCAAGTGCAGTATGCCCTGCCGGGTGAG
CGTGTGGAGGGCTTGTGA